2MSY: Hox homeodomain

Solution structure of Hox homeodomain. Determined by solution NMR. Released 16 Sept 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 608
Mol. weight: 8.68 kDa
Released: 16 Sept 2015

Explore 2MSY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MSY contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	18-29	12
α-helix	36-45	10
α-helix	50-65	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Homeobox protein Hox-C9	A	protein	68	Homo sapiens	P31274 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MSY_1 Homeobox protein Hox-C9 (chains A)
ANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNR
RMKMKKMN

Primary citation

Structural insight into the interaction between the Hox and HMGB1 and understanding of the HMGB1-enhancing effect of Hox-DNA binding. Kim, H.H., Park, S.J., Han, J.H. et al. Biochim Biophys Acta (2015) 1854:449-459. DOI 10.1016/j.bbapap.2015.02.009 · PubMed

Other PDB entries of the same protein (UniProt P31274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2LP0 The solution structure of homeodomain-protein complex

Browse structure collections

About this viewer

MolViewer shows 2MSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.