2MUM: PHD domain of Yeast YNG2

Solution structure of the PHD domain of Yeast YNG2. Determined by solution NMR. Released 24 Dec 2014.

Method: Solution NMR
Organism: Saccharomyces cerevisiae S288c
Chains: 1
Atoms: 415
Mol. weight: 6.07 kDa
Ligands: ZN
Released: 24 Dec 2014

Explore 2MUM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MUM contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	223	1	1
β-strand	230	1	1
β-strand	236-237	2	2
β-strand	247-248	2	2
α-helix	258-259	2
α-helix	266-270	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromatin modification-related protein YNG2	A	protein	50	Saccharomyces cerevisiae S288c	P38806 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MUM_1 Chromatin modification-related protein YNG2 (chains A)
TLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of the PHD domain of Yeast YNG2. Taeb, S., Kaustov, L., Lemak, A. et al. To be published.

Other PDB entries of the same protein (UniProt P38806 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5J9T 2.7 Å, Crystal structure of the NuA4 core complex
5J9W 2.8 Å, Crystal structure of the NuA4 core complex
5J9U 2.95 Å, Crystal structure of the NuA4 core complex
5J9Q 3.25 Å, Crystal structure of the NuA4 core complex
7VVU 3.4 Å, NuA4 HAT module bound to the nucleosome
8X2X 3.8 Å, The piccolo NuA4 bound to the H2A.Z nucleosome complex at pre-H4-acetylation state
8X2Z 3.9 Å, The class2 of piccolo NuA4 bound to the H2A.Z nucleosome complex at harboring state
8X2Y 4.1 Å, The class1 of piccolo NuA4 bound to the H2A.Z nucleosome complex at harboring state
8X30 4.3 Å, Structure of piccolo NuA4 and H2A.Z nucleosome 2:1 complex
8X32 4.4 Å, The piccolo NuA4 bound to the H2A.Z nucleosome-H4KQ Complex with Ac-CoA at resetting state
8X31 6.2 Å, The piccolo NuA4 bound to the H2A.Z nucleosome complex with Ac-CoA at resetting state
7VVZ 8.8 Å, NuA4 bound to the nucleosome

Browse structure collections

About this viewer

MolViewer shows 2MUM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.