Solution structure of Twinstar from Drosophila melanogastor. Determined by solution NMR. Released 23 Sept 2015.
Explore 2MV2 in 3D Show helices and sheets RCSB PDB PDBe
2MV2 contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-7 | 2 | 1 |
| α-helix | 8 | 1 | |
| α-helix | 9-20 | 12 | |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 36-43 | 8 | 1 |
| α-helix | 49-59 | 11 | |
| β-strand | 65-77 | 13 | 1 |
| β-strand | 80-94 | 15 | 1 |
| α-helix | 101-113 | 13 | |
| α-helix | 114-116 | 3 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 135-144 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cofilin/actin-depolymerizing factor homolog | A | protein | 148 | Drosophila melanogaster | P45594 (AlphaFold model) |
>2MV2_1 Cofilin/actin-depolymerizing factor homolog (chains A) MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYDQFLEDIQKCG PGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVG VQKYIQATDLSEASREAVEEKLRATDRQ
Solution structure and dynamics of Twinstar from Drosophila melanogastor. Shukla, V.K., Maheshwari, D., Jain, A. et al. To be published.
Other PDB entries of the same protein (UniProt P45594 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.