2MWN: Talin-F3 / RIAM N-terminal Peptide complex

Talin-F3 / RIAM N-terminal Peptide complex. Determined by solution NMR. Released 17 Dec 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 936
Mol. weight: 13.34 kDa
Released: 17 Dec 2014

Explore 2MWN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MWN contains 2 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	11-23	13

Chain B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	311-313	3	1
β-strand	316-318	3	2
β-strand	325-327	3	2
β-strand	329-333	5	1
β-strand	336-340	5	1
β-strand	347	1	1
β-strand	351	1	1
β-strand	358-359	2	2
β-strand	365-369	5	2
β-strand	377-381	5	2
α-helix	385-399	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 precursor protein-binding family B member 1-interacting protein	A	protein	24	Homo sapiens	Q7Z5R6 (AlphaFold model)
Talin-1	B	protein	93	Homo sapiens	Q9Y490 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MWN_1 Amyloid beta A4 precursor protein-binding family B member 1-interacting protein (chains A)
DIDQMFSTLLGEMDLLTQSLGVDT

Sequence of entity 2 (B), FASTA

>2MWN_2 Talin-1 (chains B)
YGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFT
LDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL

Primary citation

Conformational activation of talin by RIAM triggers integrin-mediated cell adhesion. Yang, J., Zhu, L., Zhang, H. et al. Nat Commun (2014) 5:5880-5880. DOI 10.1038/ncomms6880 · PubMed

Other PDB entries of the same protein (UniProt Q7Z5R6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZDL 2.3 Å, Vinculin head (1-258) in complex with a RIAM fragment

Browse structure collections

About this viewer

MolViewer shows 2MWN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.