2MXC: Full length sorting nexin 3

Solution structure of the full length sorting nexin 3. Determined by solution NMR. Released 4 May 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,408
Mol. weight: 19.95 kDa
Released: 4 May 2016

Explore 2MXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MXC contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	29-38	10	1
β-strand	47-55	9	1
β-strand	64-70	7	1
α-helix	71-84	14
α-helix	89-92	4
α-helix	97-99	3
α-helix	112-129	18
α-helix	140-145	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-3	A	protein	172	Homo sapiens	O60493 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MXC_1 Sorting nexin-3 (chains A)
MAHHHHHHVGTAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYE
IRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIF
DDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA

Primary citation

Phosphorylation of conserved phosphoinositide binding pocket regulates sorting nexin membrane targeting. Lenoir, M., Ustunel, C., Rajesh, S. et al. Nat Commun (2018) 9:993-993. DOI 10.1038/s41467-018-03370-1 · PubMed

Other PDB entries of the same protein (UniProt O60493 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YPS 2.6 Å, Crystal structure of the PX domain of human sorting nexin 3
5F0J 2.7 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3
5F0P 2.78 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1(L557M) (SeMet labeled)
5F0M 3.1 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1 (SeMet labeled)
5F0L 3.2 Å, Structure of retromer VPS26-VPS35 subunits bound to SNX3 and DMT1
7BLO 9.5 Å, VPS26 dimer region of metazoan membrane-assembled retromer:SNX3 complex modelled with…

Browse structure collections

About this viewer

MolViewer shows 2MXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.