2N1D: MRG15-MRGBP complex

Solution structure of the MRG15-MRGBP complex. Determined by solution NMR. Released 27 May 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,845
Mol. weight: 26.13 kDa
Released: 27 May 2015

Explore 2N1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N1D contains 17 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	73-75	3
α-helix	77-83	7
α-helix	88-93	6
β-strand	104	1	1
α-helix	109-115	7

Chain B: 13 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-172	8
α-helix	173-177	5
β-strand	180-181	2	2
α-helix	190-204	15
α-helix	209-226	18
β-strand	234	1	1
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-257	4
α-helix	264-273	10
α-helix	281-300	20
α-helix	302-304	3
α-helix	308-310	3
β-strand	312-313	2	2
α-helix	314-315	2
α-helix	316-319	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MRG/MORF4L-binding protein	A	protein	54	Homo sapiens	Q9NV56 (AlphaFold model)
Mortality factor 4-like protein 1	B	protein	172	Homo sapiens	Q9UBU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N1D_1 MRG/MORF4L-binding protein (chains A)
SNAGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGK

Sequence of entity 2 (B), FASTA

>2N1D_2 Mortality factor 4-like protein 1 (chains B)
SNAEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKE
YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIG
AMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

Primary citation

Structural Basis for Multi-specificity of MRG Domains. Xie, T., Zmyslowski, A.M., Zhang, Y. et al. Structure (2015) 23:1049-1057. DOI 10.1016/j.str.2015.03.020 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2N1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.