2N1I: PR domain from PRDM16

Structure of the PR domain from PRDM16. Determined by solution NMR. Released 6 Jul 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,345
Mol. weight: 19.17 kDa
Released: 6 Jul 2016

Explore 2N1I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N1I contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	84-91	8	1
β-strand	95-100	6	1
β-strand	104	1	2
β-strand	109-110	2	3
α-helix	167-170	4
α-helix	178-180	3
β-strand	183-188	6	3
β-strand	191-196	6	3
α-helix	199	1
β-strand	200	1	2
α-helix	201	1
α-helix	216-219	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PR domain zinc finger protein 16	A	protein	176	Homo sapiens	Q9HAZ2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N1I_1 PR domain zinc finger protein 16 (chains A)
GSGFPTSEDFTPKEGSPYEAPVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERL
GPCVVVPRAAAKETDFGWEQILTDVEVSPQEGCITKISEDLGSEKFCVDANQAGAGSWLK
YIRVACSCDDQNLTMCQISEQIYYKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDE

Primary citation

Structure of the PR Domain from PRDM16. Sun, Y., Armstrong, G., Briknarova, K. To be published.

Other PDB entries of the same protein (UniProt Q9HAZ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW4 2.0 Å, Crystal structure of RBBP4 in complex with PRDM16 N-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 2N1I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.