Structure of SAP30L corepressor protein. Determined by solution NMR. Released 25 Nov 2015.
Explore 2N1U in 3D Show helices and sheets RCSB PDB PDBe
2N1U contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28 | 1 | 1 |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 36-37 | 2 | 2 |
| α-helix | 40 | 1 | |
| β-strand | 41 | 1 | 1 |
| β-strand | 42-46 | 5 | 3 |
| α-helix | 51-56 | 6 | |
| β-strand | 62-64 | 3 | 2 |
| β-strand | 72-74 | 3 | 3 |
| α-helix | 75-83 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone deacetylase complex subunit SAP30L | A | protein | 70 | Homo sapiens | Q9HAJ7 (AlphaFold model) |
>2N1U_1 Histone deacetylase complex subunit SAP30L (chains A) GSYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQ SVRNKRKRKT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Redox-dependent disulfide bond formation in SAP30L corepressor protein: Implications for structure and function. Laitaoja, M., Tossavainen, H., Pihlajamaa, T. et al. Protein Sci (2016) 25:572-586. DOI 10.1002/pro.2849 · PubMed
Other PDB entries of the same protein (UniProt Q9HAJ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.