Solution structure of the EBNA-2 N-terminal Dimerization (END) domain from the Epstein-barr virus. Determined by solution NMR. Released 10 Jun 2015.
Explore 2N2J in 3D Show helices and sheets RCSB PDB PDBe
2N2J contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| β-strand | 16-24 | 9 | 2 |
| β-strand | 30-36 | 7 | 2 |
| α-helix | 40-43 | 4 | |
| α-helix | 48 | 1 | |
| β-strand | 49-56 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| β-strand | 16-24 | 9 | 2 |
| β-strand | 30-36 | 7 | 2 |
| α-helix | 40-43 | 4 | |
| α-helix | 48 | 1 | |
| β-strand | 49-56 | 8 | 1 |
| α-helix | 57-58 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Epstein-Barr nuclear antigen 2 | A, B | protein | 62 | Human herpesvirus 4 | P12978 (AlphaFold model) |
>2N2J_1 Epstein-Barr nuclear antigen 2 (chains A, B) GAMEMPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENT GV
The EBNA-2 N-Terminal Transactivation Domain Folds into a Dimeric Structure Required for Target Gene Activation. Friberg, A., Thumann, S., Hennig, J. et al. PLoS Pathog (2015) 11:e1004910-e1004910. DOI 10.1371/journal.ppat.1004910 · PubMed
Other PDB entries of the same protein (UniProt P12978 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N2J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.