2NBU: Rad23 ubiquitin-like (UBL) domain

Solution structure of the Rad23 ubiquitin-like (UBL) domain. Determined by solution NMR. Released 20 Jul 2016.

Method: Solution NMR
Organism: Saccharomyces cerevisiae S288c
Chains: 1
Atoms: 606
Mol. weight: 11.04 kDa
Released: 20 Jul 2016

Explore 2NBU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NBU contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	13-18	6	1
β-strand	23	1	2
α-helix	24-35	12
β-strand	42-45	4	1
β-strand	50	1	1
β-strand	56	1	2
α-helix	57-60	4
β-strand	68-72	5	1
α-helix	73-75	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
UV excision repair protein RAD23	A	protein	99	Saccharomyces cerevisiae S288c	P32628 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NBU_1 UV excision repair protein RAD23 (chains A)
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSEC
GLKDGDQVVFMVSQKKSTDPNSSSVDKLAAALEHHHHHH

Primary citation

Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome. Chen, X., Randles, L., Shi, K. et al. Structure (2016) 24:1257-1270. DOI 10.1016/j.str.2016.05.018 · PubMed

Other PDB entries of the same protein (UniProt P32628 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QSF 2.35 Å, Crystal structure of the Rad4-Rad23 complex
3M62 2.4 Å, Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Rad23
1X3Z 2.8 Å, Structure of a peptide:N-glycanase-Rad23 complex
2QSH 2.81 Å, Crystal structure of Rad4-Rad23 bound to a mismatch DNA
6UG1 2.83 Å, Sequence impact in DNA duplex opening by the Rad4/XPC nucleotide excision repair complex
1X3W 3.0 Å, Structure of a peptide:N-glycanase-Rad23 complex
4YIR 3.05 Å, Crystal structure of Rad4-Rad23 crosslinked to an undamaged DNA
2QSG 3.1 Å, Crystal structure of Rad4-Rad23 bound to a UV-damaged DNA
6UIN 3.35 Å, Role of Beta-hairpin motifs in the DNA duplex opening by the Rad4/XPC nucleotide…
6CFI 3.36 Å, Crystal structure of Rad4-Rad23 bound to a 6-4 photoproduct UV lesion
3ESW 3.4 Å, Complex of yeast PNGase with GlcNAc2-IAc.
6UBF 4.6 Å, Role of Beta-hairpin motifs in the DNA duplex opening by the Rad4/XPC nucleotide…

Browse structure collections

About this viewer

MolViewer shows 2NBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.