Structure of BoNT/B in complex with its protein receptor. Determined by X-ray diffraction at 2.15 Å resolution. Released 19 Dec 2006.
Explore 2NM1 in 3D Show helices and sheets RCSB PDB PDBe
2NM1 contains 12 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 859-861 | 3 | |
| β-strand | 864-867 | 4 | 1 |
| β-strand | 868-870 | 3 | 2 |
| β-strand | 875-877 | 3 | 2 |
| β-strand | 884-887 | 4 | 3 |
| β-strand | 892-893 | 2 | 1 |
| β-strand | 898-901 | 4 | 1 |
| β-strand | 909-912 | 4 | 3 |
| β-strand | 926-933 | 8 | 1 |
| α-helix | 934-938 | 5 | |
| α-helix | 939-941 | 3 | |
| α-helix | 942-947 | 6 | |
| β-strand | 949-957 | 9 | 3 |
| β-strand | 960-967 | 8 | 3 |
| β-strand | 970-976 | 7 | 3 |
| β-strand | 982-988 | 7 | 3 |
| β-strand | 1003-1009 | 7 | 1 |
| β-strand | 1013-1018 | 6 | 1 |
| β-strand | 1021-1027 | 7 | 1 |
| β-strand | 1040-1046 | 7 | 3 |
| β-strand | 1054-1062 | 9 | 1 |
| α-helix | 1068-1079 | 12 | |
| β-strand | 1083 | 1 | 4 |
| β-strand | 1085 | 1 | 5 |
| β-strand | 1091 | 1 | 5 |
| α-helix | 1092 | 1 | |
| β-strand | 1097-1098 | 2 | 6 |
| β-strand | 1099-1102 | 4 | 7 |
| β-strand | 1108-1112 | 5 | 6 |
| α-helix | 1113 | 1 | |
| β-strand | 1119-1123 | 5 | 6 |
| α-helix | 1124-1125 | 2 | |
| β-strand | 1126 | 1 | 8 |
| β-strand | 1137 | 1 | 8 |
| α-helix | 1143-1144 | 2 | |
| β-strand | 1145-1149 | 5 | 6 |
| β-strand | 1162 | 1 | 4 |
| β-strand | 1166-1173 | 8 | 6 |
| β-strand | 1176-1181 | 6 | 6 |
| β-strand | 1182-1183 | 2 | 9 |
| β-strand | 1190-1192 | 3 | 6 |
| α-helix | 1193 | 1 | |
| β-strand | 1194-1197 | 4 | 6 |
| β-strand | 1204-1205 | 2 | 9 |
| β-strand | 1208-1211 | 4 | 6 |
| β-strand | 1221 | 1 | 7 |
| β-strand | 1222-1226 | 5 | 6 |
| β-strand | 1234-1244 | 11 | 6 |
| β-strand | 1253-1260 | 8 | 6 |
| α-helix | 1262-1266 | 5 | |
| β-strand | 1280-1283 | 4 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 47-59 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Botulinum neurotoxin type B | A | protein | 436 | Clostridium botulinum | P10844 (AlphaFold model) |
| Synaptotagmin-2 | B | protein | 17 | Rattus norvegicus | P29101 (AlphaFold model) |
>2NM1_1 Botulinum neurotoxin type B (chains A) SEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRVTQNQNI IFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNSGWKISIRGNRIIWTLID INGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIAN GEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKE YYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQSIN DDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKEYDEQP TYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKPYNLKLG CNWQFIPKDEGWTEPP
>2NM1_2 Synaptotagmin-2 (chains B) EDMFAKLKDKFFNEINK
Botulinum neurotoxin B recognizes its protein receptor with high affinity and specificity. Jin, R., Rummel, A., Binz, T. et al. Nature (2006) 444:1092-1095. DOI 10.1038/nature05387 · PubMed
Other PDB entries of the same protein (UniProt P10844 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NM1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.