Bacteriorhodopsin, wild type, after illumination to produce the L intermediate. Determined by X-ray diffraction at 1.53 Å resolution. Released 26 Dec 2006.
Explore 2NTW in 3D Show helices and sheets RCSB PDB PDBe
2NTW contains 10 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-30 | 21 | |
| α-helix | 37-61 | 25 | |
| β-strand | 67-71 | 5 | 1 |
| β-strand | 74-78 | 5 | 1 |
| α-helix | 81-100 | 20 | |
| α-helix | 105-127 | 23 | |
| α-helix | 131-154 | 24 | |
| α-helix | 165-191 | 27 | |
| α-helix | 201-213 | 13 | |
| α-helix | 214-218 | 5 | |
| α-helix | 219-225 | 7 | |
| α-helix | 227-229 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bacteriorhodopsin | A | protein | 249 | Halobacterium salinarum | P02945 (AlphaFold model) |
>2NTW_1 Bacteriorhodopsin (chains A) QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSM LLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIG TGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVV LWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATSD
| ID | Name | Formula | Copies |
|---|---|---|---|
| RET | Retinal | C20 H28 O | 1 |
Structural changes in the L photointermediate of bacteriorhodopsin. Lanyi, J.K., Schobert, B. J Mol Biol (2007) 365:1379-1392. DOI 10.1016/j.jmb.2006.11.016 · PubMed
Other PDB entries of the same protein (UniProt P02945 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2NTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.