2NY4: HIV-1 gp120 Envelope Glycoprotein
HIV-1 gp120 Envelope Glycoprotein (K231C, T257S, E268C, S334A, S375W) Complexed with CD4 and Antibody 17b. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Feb 2007.
- Method
- X-ray diffraction
- Resolution
- 2.0 Å
- Organisms
- Human immunodeficiency virus 1, Homo sapiens
- Chains
- 4
- Atoms
- 7,824
- Mol. weight
- 106.69 kDa
- Ligands
- HEZ, NAG
- Released
- 6 Feb 2007
Explore 2NY4 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2NY4 contains 32 α-helices and 90 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 10 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 84-85 | 2 | 1 |
| β-strand | 91-94 | 4 | 2 |
| α-helix | 99-114 | 16 | |
| β-strand | 120-123 | 4 | 3 |
| β-strand | 199-202 | 4 | 3 |
| β-strand | 215 | 1 | 4 |
| β-strand | 218 | 1 | 5 |
| α-helix | 219-220 | 2 | |
| β-strand | 223-228 | 6 | 1 |
| β-strand | 236-239 | 4 | 2 |
| β-strand | 242-245 | 4 | 1 |
| β-strand | 247 | 1 | 5 |
| α-helix | 248-250 | 3 | |
| β-strand | 251 | 1 | 4 |
| β-strand | 259-261 | 3 | 6 |
| α-helix | 264-266 | 3 | |
| β-strand | 271-273 | 3 | 6 |
| α-helix | 283 | 1 | |
| β-strand | 284-297 | 14 | 6 |
| β-strand | 330-334 | 5 | 6 |
| α-helix | 335-353 | 19 | |
| β-strand | 358-361 | 4 | 6 |
| β-strand | 367 | 1 | 7 |
| α-helix | 369-372 | 4 | |
| β-strand | 374-378 | 5 | 8 |
| β-strand | 381-385 | 5 | 8 |
| α-helix | 388-390 | 3 | |
| β-strand | 393-395 | 3 | 6 |
| β-strand | 413-417 | 5 | 6 |
| β-strand | 418-421 | 4 | 8 |
| β-strand | 423-425 | 3 | 3 |
| β-strand | 432-434 | 3 | 3 |
| α-helix | 436-438 | 3 | |
| β-strand | 444-456 | 13 | 6 |
| β-strand | 465-470 | 6 | 6 |
| α-helix | 475-483 | 9 | |
| β-strand | 486-490 | 5 | 1 |
Chain B: 4 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1002-1007 | 6 | 7 |
| β-strand | 1012-1014 | 3 | 9 |
| β-strand | 1017 | 1 | 10 |
| β-strand | 1026-1030 | 5 | 7 |
| β-strand | 1035-1040 | 6 | 7 |
| β-strand | 1043-1046 | 4 | 7 |
| α-helix | 1052-1054 | 3 | |
| β-strand | 1055-1056 | 2 | 9 |
| α-helix | 1059-1064 | 6 | |
| β-strand | 1066 | 1 | 10 |
| β-strand | 1069-1071 | 3 | 9 |
| α-helix | 1076-1078 | 3 | |
| β-strand | 1080-1086 | 7 | 7 |
| β-strand | 1089-1098 | 10 | 7 |
| β-strand | 1099-1102 | 4 | 11 |
| β-strand | 1108-1109 | 2 | 12 |
| β-strand | 1114-1119 | 6 | 11 |
| β-strand | 1127-1131 | 5 | 13 |
| β-strand | 1137-1140 | 4 | 13 |
| β-strand | 1143-1146 | 4 | 11 |
| α-helix | 1151-1153 | 3 | |
| β-strand | 1155-1163 | 9 | 13 |
| β-strand | 1166-1174 | 9 | 13 |
| β-strand | 1176-1177 | 2 | 12 |
Chain C: 8 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2002-2003 | 2 | |
| β-strand | 2004-2007 | 4 | 14 |
| β-strand | 2010-2013 | 4 | 15 |
| β-strand | 2019-2025 | 7 | 14 |
| β-strand | 2033-2038 | 6 | 15 |
| β-strand | 2045-2049 | 5 | 15 |
| β-strand | 2053-2054 | 2 | 15 |
| α-helix | 2055 | 1 | |
| β-strand | 2062-2067 | 6 | 14 |
| β-strand | 2070-2075 | 6 | 14 |
| α-helix | 2080-2082 | 3 | |
| β-strand | 2085-2090 | 6 | 15 |
| β-strand | 2099-2100 | 2 | 15 |
| β-strand | 2104-2108 | 5 | 15 |
| β-strand | 2113 | 1 | 16 |
| α-helix | 2114-2115 | 2 | |
| β-strand | 2116-2120 | 5 | 17 |
| α-helix | 2121-2123 | 3 | |
| α-helix | 2124-2129 | 6 | |
| β-strand | 2131-2141 | 11 | 17 |
| β-strand | 2142 | 1 | 16 |
| β-strand | 2147-2152 | 6 | 18 |
| β-strand | 2155-2156 | 2 | 18 |
| β-strand | 2161-2165 | 5 | 17 |
| α-helix | 2166-2169 | 4 | |
| β-strand | 2175-2184 | 10 | 17 |
| α-helix | 2185-2188 | 4 | |
| β-strand | 2193-2199 | 7 | 18 |
| β-strand | 2207-2212 | 6 | 18 |
Chain D: 10 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3003-3006 | 4 | 19 |
| α-helix | 3007-3009 | 3 | |
| β-strand | 3010-3012 | 3 | 20 |
| β-strand | 3018-3025 | 8 | 19 |
| α-helix | 3029-3031 | 3 | |
| β-strand | 3032-3039 | 8 | 20 |
| β-strand | 3045-3052 | 8 | 20 |
| β-strand | 3057-3060 | 4 | 20 |
| β-strand | 3068-3073 | 6 | 19 |
| β-strand | 3078-3083 | 6 | 19 |
| α-helix | 3088-3090 | 3 | |
| β-strand | 3092-3100 | 9 | 20 |
| α-helix | 3104-3106 | 3 | |
| β-strand | 3117-3118 | 2 | 20 |
| β-strand | 3122-3126 | 5 | 20 |
| α-helix | 3129-3131 | 3 | |
| β-strand | 3132 | 1 | 21 |
| α-helix | 3133-3134 | 2 | |
| β-strand | 3135-3139 | 5 | 22 |
| β-strand | 3150-3160 | 11 | 22 |
| β-strand | 3161 | 1 | 21 |
| β-strand | 3166-3169 | 4 | 23 |
| α-helix | 3170-3172 | 3 | |
| β-strand | 3174 | 1 | 23 |
| β-strand | 3178-3180 | 3 | 22 |
| α-helix | 3181-3183 | 3 | |
| β-strand | 3184-3185 | 2 | 22 |
| β-strand | 3191-3200 | 10 | 22 |
| α-helix | 3201-3203 | 3 | |
| β-strand | 3210-3215 | 6 | 23 |
| α-helix | 3216-3218 | 3 | |
| β-strand | 3220-3225 | 6 | 23 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Envelope glycoprotein GP120 | A | protein | 317 | Human immunodeficiency virus 1 | Q73401 |
| T-cell surface glycoprotein CD4 | B | protein | 184 | Homo sapiens | P01730 (AlphaFold model) |
| Antibody 17B, light chain | C | protein | 214 | Homo sapiens | P01834 (AlphaFold model) |
| Antibody 17B, heavy chain | D | protein | 229 | Homo sapiens | P01857 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>2NY4_1 ENVELOPE GLYCOPROTEIN GP120 (chains A)
EVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVGAGSCNTSVITQACP
KVSFEPIPIHYCAPAGFAILKCNNCTFNGTGPCTNVSTVQCTHGIRPVVSSQLLLNGSLA
ECEVVIRSVNFTDNAKTIIVQLNTSVEINCTGAGHCNIARAKWNNTLKQIASKLREQFGN
NKTIIFKQSSGGDPEIVTHWFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTIT
LPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDM
RDNWRSELYKYKVVKIE
Sequence of entity 2 (B), FASTA
>2NY4_2 T-cell surface glycoprotein CD4 (chains B)
MKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRR
SLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLE
SPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAF
QKAS
Sequence of entity 3 (C), FASTA
>2NY4_3 ANTIBODY 17B, LIGHT CHAIN (chains C)
DIVMTQSPATLSVSPGERATLSCRASESVSSDLAWYQQKPGQAPRLLIYGASTRATGVPA
RFSGSGSGAEFTLTISSLQSEDFAVYYCQQYNNWPPRYTFGQGTRLEIKRTVAAPSVFIF
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
Sequence of entity 4 (D), FASTA
>2NY4_4 ANTIBODY 17B, HEAVY CHAIN (chains D)
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHY
APHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQ
GTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| HEZ | Hexane-1,6-diol | C6 H14 O2 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 13 |
Primary citation
Structural definition of a conserved neutralization epitope on HIV-1 gp120. Zhou, T., Xu, L., Dey, B. et al. Nature (2007) 445:732-737. DOI 10.1038/nature05580 · PubMed
Browse structure collections
About this viewer
MolViewer shows 2NY4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.