2O2L: Human heat-labile enterotoxin

Name: PDB 2O2L: Crystal structure of human heat-labile enterotoxin in complex with a blood group A antigen analog
Published: 2007-08-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of human heat-labile enterotoxin in complex with a blood group A antigen analog. Determined by X-ray diffraction at 2.53 Å resolution. Released 14 Aug 2007.

Method: X-ray diffraction
Resolution: 2.53 Å
Organism: Escherichia coli
Chains: 10
Atoms: 8,893
Mol. weight: 125.69 kDa
Released: 14 Aug 2007

Explore 2O2L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O2L contains 37 α-helices and 62 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	51-52	2
α-helix	60-77	18
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain E: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain G: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	1
β-strand	26-32	7	1
β-strand	35-41	7	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	59-78	20
α-helix	80-81	2
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain H: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	51-53	3
α-helix	61-77	17
β-strand	82-88	7	1
β-strand	94-102	9	1

Chain I: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-22	8	2
β-strand	26-30	5	2
β-strand	37-41	5	2
β-strand	47-50	4	2
α-helix	60-77	18
α-helix	80-81	2
β-strand	82-88	7	2
β-strand	94-102	9	2

Chain J: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	2
β-strand	26-30	5	2
β-strand	38-41	4	2
β-strand	47-50	4	2
α-helix	51-53	3
α-helix	59-78	20
α-helix	80	1
β-strand	81-88	8	2
β-strand	94-102	9	2

Chain K: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-10	6
β-strand	15-22	8	2
β-strand	26-32	7	2
β-strand	35-41	7	2
β-strand	47-50	4	2
α-helix	51-53	3
α-helix	60-77	18
α-helix	80-81	2
β-strand	82-88	7	2
β-strand	94-102	9	2

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat-labile enterotoxin B chain	D, E, F, G, H, I, J, K, L, M	protein	103	Escherichia coli	P0CK94 (AlphaFold model)

Sequence of entity 1 (D, E, F, G, H, I, J, K, L, M), FASTA

>2O2L_1 Heat-labile enterotoxin B chain (chains D, E, F, G, H, I, J, K, L, M)
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEK

Primary citation

Blood Group Antigen Recognition by Escherichia coli Heat-labile Enterotoxin. Holmner, A., Askarieh, G., Okvist, M. et al. J Mol Biol (2007) 371:754-764. DOI 10.1016/j.jmb.2007.05.064 · PubMed

Other PDB entries of the same protein (UniProt P0CK94 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EFX 1.94 Å, Novel binding site identified in a hybrid between cholera toxin and heat-labile…
1LTR 3.04 Å, Crystal structure of the B subunit of human heat-labile enterotoxin from E. Coli…
1B44 3.3 Å, Crystal structure of the B subunit of heat-labile enterotoxin from E. Coli carrying a…

Browse structure collections

About this viewer

MolViewer shows 2O2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.