2O2L: Human heat-labile enterotoxin
Crystal structure of human heat-labile enterotoxin in complex with a blood group A antigen analog. Determined by X-ray diffraction at 2.53 Å resolution. Released 14 Aug 2007.
- Method
- X-ray diffraction
- Resolution
- 2.53 Å
- Organism
- Escherichia coli
- Chains
- 10
- Atoms
- 8,893
- Mol. weight
- 125.69 kDa
- Released
- 14 Aug 2007
Explore 2O2L in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2O2L contains 37 α-helices and 62 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain D: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-52 | 2 | |
| α-helix | 60-77 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain E: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain F: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain G: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-32 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain H: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 1 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 37-41 | 5 | 1 |
| β-strand | 47-50 | 4 | 1 |
| α-helix | 51-53 | 3 | |
| α-helix | 61-77 | 17 | |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 94-102 | 9 | 1 |
Chain I: 3 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-22 | 8 | 2 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 37-41 | 5 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 60-77 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 2 |
| β-strand | 94-102 | 9 | 2 |
Chain J: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-9 | 5 | |
| β-strand | 15-23 | 9 | 2 |
| β-strand | 26-30 | 5 | 2 |
| β-strand | 38-41 | 4 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 59-78 | 20 | |
| α-helix | 80 | 1 | |
| β-strand | 81-88 | 8 | 2 |
| β-strand | 94-102 | 9 | 2 |
Chain K: 4 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-10 | 6 | |
| β-strand | 15-22 | 8 | 2 |
| β-strand | 26-32 | 7 | 2 |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 47-50 | 4 | 2 |
| α-helix | 51-53 | 3 | |
| α-helix | 60-77 | 18 | |
| α-helix | 80-81 | 2 | |
| β-strand | 82-88 | 7 | 2 |
| β-strand | 94-102 | 9 | 2 |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Heat-labile enterotoxin B chain | D, E, F, G, H, I, J, K, L, M | protein | 103 | Escherichia coli | P0CK94 (AlphaFold model) |
Sequence of entity 1 (D, E, F, G, H, I, J, K, L, M), FASTA
>2O2L_1 Heat-labile enterotoxin B chain (chains D, E, F, G, H, I, J, K, L, M)
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEK
Primary citation
Blood Group Antigen Recognition by Escherichia coli Heat-labile Enterotoxin. Holmner, A., Askarieh, G., Okvist, M. et al. J Mol Biol (2007) 371:754-764. DOI 10.1016/j.jmb.2007.05.064 · PubMed
Other PDB entries of the same protein (UniProt P0CK94 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3EFX 1.94 Å, Novel binding site identified in a hybrid between cholera toxin and heat-labile…
- 1LTR 3.04 Å, Crystal structure of the B subunit of human heat-labile enterotoxin from E. Coli…
- 1B44 3.3 Å, Crystal structure of the B subunit of heat-labile enterotoxin from E. Coli carrying a…
Browse structure collections
About this viewer
MolViewer shows 2O2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.