2O2V: PDB entry 2O2V

Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox). Determined by X-ray diffraction at 1.83 Å resolution. Released 12 Dec 2006.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,520
Mol. weight: 22.43 kDa
Released: 12 Dec 2006

Explore 2O2V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O2V contains 8 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
β-strand	27-33	7	1
α-helix	41-51	11
β-strand	59-63	5	2
β-strand	69-72	4	2
α-helix	75-95	21
α-helix	97-99	3
β-strand	102-104	3	1
β-strand	105-107	3	2

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	44	1
β-strand	45-51	7	3
β-strand	54-60	7	3
α-helix	61	1
α-helix	64-65	2
α-helix	66-77	12
β-strand	82-87	6	3
β-strand	90-94	5	3
α-helix	97-109	13
β-strand	116-121	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dual specificity mitogen-activated protein kinase kinase 5	A	protein	106	Homo sapiens	Q13163 (AlphaFold model)
Mitogen-activated protein kinase kinase kinase 3	B	protein	90	Homo sapiens	Q99759 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2O2V_1 Dual specificity mitogen-activated protein kinase kinase 5 (chains A)
SMALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEY
EDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRA

Sequence of entity 2 (B), FASTA

>2O2V_2 Mitogen-activated protein kinase kinase kinase 3 (chains B)
SMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILL
KNQDDLDKAIDILDRSSSMKSLRILLLSQD

Primary citation

Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox). Filippakopoulos, P., Savitsky, P., Ugochukwu, E. et al. To be published.

Other PDB entries of the same protein (UniProt Q13163 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NPT 1.75 Å, Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox…
4IC7 2.6 Å, Crystal structure of the ERK5 kinase domain in complex with an MKK5 binding fragment

Browse structure collections

About this viewer

MolViewer shows 2O2V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.