Crystal structure of 1E9 LeuH47Trp/ArgH100Trp, an engineered Diels-Alderase Fab with nM steroid-binding affinity. Determined by X-ray diffraction at 2.05 Å resolution. Released 18 Dec 2007.
Explore 2O5X in 3D Show helices and sheets RCSB PDB PDBe
2O5X contains 18 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 7 |
| β-strand | 10-12 | 3 | 8 |
| β-strand | 18-25 | 8 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 8 |
| β-strand | 46-51 | 6 | 8 |
| β-strand | 57-59 | 3 | 8 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 7 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 8 |
| β-strand | 100A-103 | 5 | 8 |
| β-strand | 107-111 | 5 | 8 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 9 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 10 |
| β-strand | 137-147 | 11 | 10 |
| β-strand | 148 | 1 | 9 |
| β-strand | 153-157 | 4 | 11 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 11 |
| β-strand | 171-173 | 3 | 10 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 10 |
| β-strand | 185-194 | 10 | 10 |
| α-helix | 195-199 | 3 | |
| β-strand | 207-212 | 6 | 11 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 4 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 145-150 | 6 | 6 |
| β-strand | 153-154 | 2 | 6 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 5 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 6 |
| β-strand | 205-210 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| chimeric antibody Fab 1E9-DB3 | L | protein | 219 | Mus musculus, Homo sapiens | P01631 (AlphaFold model), P01834 (AlphaFold model) |
| chimeric antibody Fab 1E9-DB3 | H | protein | 227 | Mus musculus, Homo sapiens | P01857 (AlphaFold model) |
>2O5X_1 chimeric antibody Fab 1E9-DB3 (chains L) ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKFLIYKVSNRF SGVPDRFSGSGSGTDFILKISRVEAEDLGVYFCFQSTHFFPTFGGGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>2O5X_2 chimeric antibody Fab 1E9-DB3 (chains H) QVQLVQSGPELKKPGETVKISCKASGYMFTNYGMNWVKQAPGKALKWMGWINPYTGESTF ADDFKGRFAFFLETSATTAYLQINNLKNEDTATYFCARGTTIVWAMDYWGQGTSVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPLSCDKTHT
Closely related antibody receptors exploit fundamentally different strategies for steroid recognition. Verdino, P., Aldag, C., Hilvert, D. et al. Proc Natl Acad Sci U S A (2008) 105:11725-11730. DOI 10.1073/pnas.0801783105 · PubMed
Other PDB entries of the same protein (UniProt P01631 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2O5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.