2O61: NFkB, IRF7, IRF3

Crystal Structure of NFkB, IRF7, IRF3 bound to the interferon-b enhancer. Determined by X-ray diffraction at 2.8 Å resolution. Released 24 Jul 2007.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,912
Mol. weight: 117.74 kDa
Released: 24 Jul 2007

Explore 2O61 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O61 contains 30 α-helices and 69 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	1
α-helix	26	1
β-strand	27	1	2
α-helix	28	1
β-strand	35-36	2	3
β-strand	48	1	2
β-strand	60-64	5	1
β-strand	71-77	7	4
α-helix	84	1
β-strand	85	1	4
α-helix	86	1
β-strand	89-91	3	3
β-strand	95-96	2	4
β-strand	99-103	5	4
α-helix	104-105	2
β-strand	110-112	3	1
β-strand	117-120	4	3
α-helix	121-122	2
α-helix	123-125	3
α-helix	126-135	10
β-strand	156-157	2	5
β-strand	158-166	9	4
β-strand	172-174	3	4
β-strand	178-179	2	4
β-strand	183-184	2	5
α-helix	193-194	2
β-strand	196-199	4	6
β-strand	203-205	3	7
β-strand	211-216	6	6
β-strand	220	1	8
β-strand	223	1	8
β-strand	225-230	6	7
β-strand	233-236	4	7
β-strand	238	1	6
α-helix	241-243	3
β-strand	244-245	2	6
β-strand	249-253	5	6
α-helix	254-257	4
β-strand	266-273	8	7
α-helix	275-277	3
β-strand	280	1	7
β-strand	284-289	6	7
α-helix	1014-1024	11
β-strand	1031-1032	2	9
β-strand	1039-1043	5	9
α-helix	1055-1057	3
α-helix	1058-1066	9
α-helix	1084-1102	19
β-strand	1105-1111	7	9
β-strand	1119-1124	6	9
α-helix	2010-2018	9
β-strand	2025-2026	2	10
β-strand	2034-2037	4	10
α-helix	2049-2051	3
α-helix	2052-2059	8
α-helix	2073-2084	12
β-strand	2090-2096	7	10
β-strand	2104-2109	6	10

Chain B: 10 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	41-44	4	11
α-helix	47	1
β-strand	48	1	12
α-helix	49	1
β-strand	53	1	13
α-helix	54-55	2
β-strand	56	1	14
α-helix	58-60	3
β-strand	69	1	12
β-strand	73	1	15
β-strand	76	1	15
β-strand	81-85	5	11
β-strand	91-98	8	16
β-strand	106	1	16
β-strand	110-113	4	14
β-strand	116-117	2	16
β-strand	120-125	6	16
β-strand	131-133	3	11
β-strand	137-140	4	14
α-helix	147-160	14
α-helix	188-204	17
β-strand	209-215	7	16
β-strand	217-218	2	17
β-strand	227-228	2	17
β-strand	232-238	7	16
β-strand	239	1	13
β-strand	250-253	4	18
β-strand	257-259	3	19
β-strand	265-270	6	18
α-helix	275-277	3
β-strand	278-286	9	19
β-strand	290-295	6	19
β-strand	297	1	18
α-helix	300-302	3
β-strand	303-304	2	18
β-strand	308-312	5	18
α-helix	313-316	4
β-strand	325-333	9	19
β-strand	339	1	19
α-helix	340-342	3
β-strand	343-348	6	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
36-MER	E	DNA	36
34-MER	F	DNA	34
Transcription factor p65/Interferon regulatory factor 7/Interferon regulatory factor 3 fusion…	A	protein	540	Homo sapiens	Q04206 (AlphaFold model), Q14653 (AlphaFold model), Q92985 (AlphaFold model)
Nuclear factor NF-kappa-B p105 subunit	B	protein	314	Homo sapiens	P19838 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>2O61_1 36-MER (chains E)
TTGAAAGGGAGAAGTGAAAGTGGGAAATTCCTCTGT

Sequence of entity 2 (F), FASTA

>2O61_2 34-MER (chains F)
CAGAGGAATTTCCCACTTTCACTTCTCCCTTTCA

Sequence of entity 3 (A), FASTA

>2O61_3 Transcription factor p65/Interferon regulatory factor 7/Interferon regulatory factor 3 fusion protein (chains A)
MGYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLV
TKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTN
NNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKIC
RVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPY
ADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDGSLSSGSSLSSPSAGAAPRVLFGEWL
LGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGG
PPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADQHKVYALSGSLSSDSSLSSPS
ALSPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNGLEHHHHHH

Sequence of entity 4 (B), FASTA

>2O61_4 Nuclear factor NF-kappa-B p105 subunit (chains B)
MDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQ
LVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMT
EACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTA
FLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKD
DIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSD
LETSEPKPFLYYPE

Primary citation

An Atomic Model of the Interferon-beta Enhanceosome. Panne, D., Maniatis, T., Harrison, S.C. Cell (2007) 129:1111-1123. DOI 10.1016/j.cell.2007.05.019 · PubMed

Other PDB entries of the same protein (UniProt Q04206 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NV2 1.13 Å, 14-3-3 sigma with RelA/p65 binding site pS45 in complex with DP005
6QHL 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45
7BI3 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-179
7BIQ 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-180
7BIW 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-187
7NV4 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-188
7NVI 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-186
7NWS 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-185
7NXS 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-184
7NXT 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-183
7NXW 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-182
7NXY 1.2 Å, 14-3-3 sigma with RelA/p65 binding site pS45 and covalently bound TCF521-181

Browse structure collections

About this viewer

MolViewer shows 2O61 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.