2ODD: MYND domain from AML1-ETO

Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor. Determined by solution NMR. Released 19 Jun 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 485
Mol. weight: 9.11 kDa
Ligands: ZN
Released: 19 Jun 2007

Explore 2ODD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ODD contains 2 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	672-674	3	1
β-strand	681-682	2	1
α-helix	685-695	11

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1105-1107	3
β-strand	1108-1110	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Smrt	B	protein	17	Homo sapiens	Q9Y618 (AlphaFold model)
Protein CBFA2T1	A	protein	64	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2ODD_1 SMRT (chains B)
GSGSTISNPPPLISSAK

Sequence of entity 2 (A), FASTA

>2ODD_2 Protein CBFA2T1 (chains A)
ENLYFQGENLYFQGDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTL
QAQQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity. Liu, Y., Chen, W., Gaudet, J. et al. Cancer Cell (2007) 11:483-497. DOI 10.1016/j.ccr.2007.04.010 · PubMed

Other PDB entries of the same protein (UniProt Q9Y618 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8B94 1.55 Å, Crystal structure of PPARG and NCOR2 with BAY-5516, an inverse agonist
8B92 1.66 Å, Crystal structure of PPARG and NCOR2 with an inverse agonist (compound SI-2)
8B95 1.72 Å, Crystal structure of PPARG and NCOR2 with BAY-9683, an inverse agonist
8B8X 1.78 Å, Crystal structure of PPARG and NCOR2 with SR10221, an inverse agonist
5ZOO 1.85 Å, Crystal structure of histone deacetylase 4 (HDAC4) in complex with a SMRT corepressor…
8B8W 1.86 Å, Crystal structure of PPARG and NCOR2 with an inverse agonist (compound 7a)
8AQN 1.9 Å, Crystal structure of PPARG and NCOR2 with BAY-4931, an inverse agonist (compound 6c)
8B8Y 2.0 Å, Crystal structure of PPARG and NCOR2 with an inverse agonist (compound 7e)
4A69 2.06 Å, Structure of HDAC3 bound to corepressor and inositol tetraphosphate
6PDZ 2.1 Å, Crystal structure of PPARgamma ligand binding domain in complex with SMRT peptide and…
8B90 2.1 Å, Crystal structure of PPARG and NCOR2 with an inverse agonist (compound 7d)
9XMJ 2.18 Å, A Potent and Selective ROR gamma Inhibitor for the Treatment of Autoimmune Diseases

Browse structure collections

About this viewer

MolViewer shows 2ODD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.