2ODX: Zn(II)Cox4

Solution structure of Zn(II)Cox4. Determined by solution NMR. Released 9 Jan 2007.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 423
Mol. weight: 9.06 kDa
Ligands: ZN
Released: 9 Jan 2007

Explore 2ODX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ODX contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	99-100	2	1
β-strand	109-111	3	2
β-strand	122-124	3	2
β-strand	131-133	3	1
β-strand	140-143	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytochrome c oxidase polypeptide IV	A	protein	80	Saccharomyces cerevisiae	P04037 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ODX_1 Cytochrome c oxidase polypeptide IV (chains A)
MMADVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCW
ECGSVYKLNPVGVPNDDHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

The characterization and role of zinc binding in yeast cox4. Coyne, H.J., Ciofi-Baffoni, S., Banci, L. et al. J Biol Chem (2007) 282:8926-8934. DOI 10.1074/jbc.M610303200 · PubMed

Other PDB entries of the same protein (UniProt P04037 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9ETZ 2.4 Å, III2IV respiratory supercomplex from Saccharomyces cerevisiae
9BPB 2.57 Å, Tethered respiratory III2IV2 supercomplex from Saccharomyces cerevisiae
1HR8 2.7 Å, Yeast Mitochondrial Processing Peptidase beta-E73Q Mutant Complexed with Cytochrome C…
6T0B 2.8 Å, The III2-IV(5B)2 respiratory supercomplex from S. cerevisiae
8DH6 2.94 Å, Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV)…
6YMX 3.17 Å, CIII2/CIV respiratory supercomplex from Saccharomyces cerevisiae
8E7S 3.2 Å, III2IV2 respiratory supercomplex from Saccharomyces cerevisiae with 4 bound UQ6
6GIQ 3.23 Å, Saccharomyces cerevisiae respiratory supercomplex III2IV
6T15 3.29 Å, The III2-IV(5B)1 respiratory supercomplex from S. cerevisiae
8EC0 3.3 Å, III2IV respiratory supercomplex from Saccharomyces cerevisiae cardiolipin-lacking mutant
6HU9 3.35 Å, III2-IV2 mitochondrial respiratory supercomplex from S. cerevisiae
6YMY 3.41 Å, Cytochrome c oxidase from Saccharomyces cerevisiae

Browse structure collections

About this viewer

MolViewer shows 2ODX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.