ArfGap domain of HIV-1 Rev binding protein. Determined by X-ray diffraction at 1.48 Å resolution. Released 30 Jan 2007.
Explore 2OLM in 3D Show helices and sheets RCSB PDB PDBe
2OLM contains 9 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-21 | 18 | |
| α-helix | 24-27 | 4 | |
| β-strand | 39-41 | 3 | 1 |
| β-strand | 46-48 | 3 | 1 |
| α-helix | 50-56 | 7 | |
| α-helix | 62-63 | 2 | |
| β-strand | 65-67 | 3 | 1 |
| α-helix | 75-83 | 9 | |
| α-helix | 85-93 | 9 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 130-134 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nucleoporin-like protein RIP | A | protein | 140 | Homo sapiens | P52594 (AlphaFold model) |
>2OLM_1 Nucleoporin-like protein RIP (chains A) GSSAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNP PHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKY EKKRWYVPPEQAKVVASVHA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (GOL, UNX, UNL, SO4) are not listed.
ArfGap domain of HIV-1 Rev binding protein. Tong, Y., Tempel, W., Shen, L. et al. To be published.
Other PDB entries of the same protein (UniProt P52594 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.