2OOA: UBA domain from Cbl-b ubiquitin ligase

Name: PDB 2OOA: crystal structure of the UBA domain from Cbl-b ubiquitin ligase
Published: 2007-02-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

crystal structure of the UBA domain from Cbl-b ubiquitin ligase. Determined by X-ray diffraction at 1.56 Å resolution. Released 6 Feb 2007.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: Homo sapiens
Chains: 2
Atoms: 796
Mol. weight: 11.41 kDa
Released: 6 Feb 2007

Explore 2OOA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OOA contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	933-941	9
α-helix	946-955	10
α-helix	960-970	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CBL-B	A, B	protein	52	Homo sapiens	Q13191 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2OOA_1 E3 ubiquitin-protein ligase CBL-B (chains A, B)
GSGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFP

Primary citation

Structural basis for ubiquitin-mediated dimerization and activation of the ubiquitin protein ligase Cbl-b. Peschard, P., Kozlov, G., Lin, T. et al. Mol Cell (2007) 27:474-485. DOI 10.1016/j.molcel.2007.06.023 · PubMed

Other PDB entries of the same protein (UniProt Q13191 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QTG 1.42 Å, Crystal structure of CBL-b in complex with an allosteric inhibitor (compound 9)
8QTJ 1.52 Å, Crystal structure of Cbl-b in complex with an allosteric inhibitor (compound 30)
9FQJ 1.56 Å, E3 ligase Cbl-b in complex with a carbamate scaffold inhibitor (compound 12)
9XZD 1.65 Å, E3 ubiquitin-protein ligase CBL-B in complex with compound 8
9I0B 1.66 Å, E3 ubiquitin ligase CBL-B in complex with inhibitor
2J6F 1.7 Å, N-terminal SH3 domain of cms (CD2AP human homolog) bound to cbl-B peptide
9XZB 1.75 Å, E3 ubiquitin-protein ligase CBL-B in complex with compound 2
8VW5 1.76 Å, Crystal structure of Cbl-b TKB bound to compound 2
10ZJ 1.77 Å, Structure of Cbl-B bound to compound 8
9FQH 1.79 Å, E3 ligase Cbl-b in complex with a triazolone core inhibitor (compound 1)
9XZC 1.8 Å, E3 ubiquitin-protein ligase CBL-B in complex with compound 6
8GCY 1.81 Å, Co-crystal structure of CBL-B in complex with N-Aryl isoindolin-1-one inhibitor

Browse structure collections

About this viewer

MolViewer shows 2OOA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.