2OQP: Human interleukin-21

Solution structure of human interleukin-21. Determined by solution NMR. Released 19 Jun 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,091
Mol. weight: 15.62 kDa
Released: 19 Jun 2007

Explore 2OQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OQP contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-23	18
α-helix	25-27	3
β-strand	33-34	2	1
α-helix	44-48	5
α-helix	50-53	4
α-helix	65-75	11
α-helix	77-79	3
β-strand	102-103	2	1
α-helix	105-115	11
α-helix	116-120	5
α-helix	121-124	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-21	A	protein	134	Homo sapiens	Q9HBE4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OQP_1 Interleukin-21 (chains A)
MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSAN
TGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMI
HQHLSSRTHGSEDS

Primary citation

The existence of multiple conformers of interleukin-21 directs engineering of a superpotent analogue. Bondensgaard, K., Breinholt, J., Madsen, D. et al. J Biol Chem (2007) 282:23326-23336. DOI 10.1074/jbc.M701313200 · PubMed

Other PDB entries of the same protein (UniProt Q9HBE4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TGX 2.8 Å, IL-21:IL21R complex
8ENT 2.83 Å, Interleukin-21 signaling complex with IL-21R and IL-2Rg

Browse structure collections

About this viewer

MolViewer shows 2OQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.