2OQQ: Transcription factor HY5

Name: PDB 2OQQ: Crystal structure of HY5 leucine zipper homodimer from Arabidopsis thaliana
Published: 2007-03-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of HY5 leucine zipper homodimer from Arabidopsis thaliana. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Mar 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 796
Mol. weight: 9.93 kDa
Released: 20 Mar 2007

Explore 2OQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OQQ contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-41	39

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-41	40

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor HY5	A, B	protein	42	Arabidopsis thaliana	O24646 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2OQQ_1 Transcription factor HY5 (chains A, B)
GSAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKN

Primary citation

Structural basis for the conformational integrity of the Arabidopsis thaliana HY5 leucine zipper homodimer. Yoon, M.K., Kim, H.M., Choi, G. et al. J Biol Chem (2007) 282:12989-13002. DOI 10.1074/jbc.M611465200 · PubMed

Other PDB entries of the same protein (UniProt O24646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QTO 1.27 Å, Crystal structure of an Arabidopsis WD40 domain in complex with a transcription factor
6QTR 1.37 Å, Crystal structure of a mutant Arabidopsis WD40 domain in complex with a transcription…
5KWN 1.42 Å, The WD domain ofArabidopsis thaliana E3 Ubiquitin Ligase COP1 in complex with peptide…

Browse structure collections

About this viewer

MolViewer shows 2OQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.