The crystal structure of the human Rac GTPase activating protein 1 (RACGAP1) MgcRacGAP. Determined by X-ray diffraction at 1.49 Å resolution. Released 27 Feb 2007.
Explore 2OVJ in 3D Show helices and sheets RCSB PDB PDBe
2OVJ contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 351-354 | 4 | |
| α-helix | 364-376 | 13 | |
| α-helix | 387-389 | 3 | |
| α-helix | 390-398 | 9 | |
| α-helix | 399-403 | 5 | |
| α-helix | 409-411 | 3 | |
| α-helix | 415-427 | 13 | |
| α-helix | 439-447 | 9 | |
| α-helix | 451-463 | 13 | |
| α-helix | 467-485 | 19 | |
| α-helix | 493-500 | 8 | |
| α-helix | 501-505 | 5 | |
| α-helix | 514-533 | 20 | |
| α-helix | 536-540 | 5 | |
| α-helix | 541-543 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rac GTPase-activating protein 1 | A | protein | 201 | Homo sapiens | Q9H0H5 (AlphaFold model) |
>2OVJ_1 Rac GTPase-activating protein 1 (chains A) SMEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKT VPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGEL PQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQP KVVERLLSLPLEYWSQFMMVE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7PE | 2-(2-(2-(2-(2-(2-ethoxyethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethanol | C14 H30 O7 | 1 |
The crystal structure of the human Rac GTPase activating protein 1 (RACGAP1) MgcRacGAP. Shrestha, L., Papagrigoriou, E., Soundararajan, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q9H0H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.