2OVJ: Rac GTPase-activating protein 1

The crystal structure of the human Rac GTPase activating protein 1 (RACGAP1) MgcRacGAP. Determined by X-ray diffraction at 1.49 Å resolution. Released 27 Feb 2007.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,794
Mol. weight: 23.06 kDa
Ligands: 7PE
Released: 27 Feb 2007

Explore 2OVJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OVJ contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	351-354	4
α-helix	364-376	13
α-helix	387-389	3
α-helix	390-398	9
α-helix	399-403	5
α-helix	409-411	3
α-helix	415-427	13
α-helix	439-447	9
α-helix	451-463	13
α-helix	467-485	19
α-helix	493-500	8
α-helix	501-505	5
α-helix	514-533	20
α-helix	536-540	5
α-helix	541-543	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rac GTPase-activating protein 1	A	protein	201	Homo sapiens	Q9H0H5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OVJ_1 Rac GTPase-activating protein 1 (chains A)
SMEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKT
VPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGEL
PQANRDTLAFLMIHLQRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQP
KVVERLLSLPLEYWSQFMMVE

Ligands and cofactors

ID	Name	Formula	Copies
7PE	2-(2-(2-(2-(2-(2-ethoxyethoxy)ethoxy)ethoxy)ethoxy)ethoxy)ethanol	C14 H30 O7	1

Primary citation

The crystal structure of the human Rac GTPase activating protein 1 (RACGAP1) MgcRacGAP. Shrestha, L., Papagrigoriou, E., Soundararajan, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H0H5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C2K 1.42 Å, Crystal structure of the fusion protein linked by RhoA and the GAP domain of MgcRacGAP
3WPQ 1.84 Å, crystal structure of the GAP domain of MgcRacGAP(S387A)
3W6R 1.9 Å, Crystal structure of the GAP domain of human MgcRacGAP
4B6D 2.2 Å, Structure of the atypical C1 domain of MgcRacGAP
5C2J 2.5 Å, Complex structure of the GAP domain of MgcRacGAP and Cdc42
3WPS 2.7 Å, crystal structure of the GAP domain of MgcRacGAP(S387D)

Browse structure collections

About this viewer

MolViewer shows 2OVJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.