2OVM: Progesterone receptor

Progesterone Receptor with Bound Asoprisnil and a Peptide from the Co-Repressor NCoR. Determined by X-ray diffraction at 2.6 Å resolution. Released 20 Mar 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,125
Mol. weight: 32.65 kDa
Ligands: AS0
Released: 20 Mar 2007

Explore 2OVM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OVM contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	686-693	8
α-helix	696-698	3
α-helix	711-733	23
α-helix	744-770	27
β-strand	776-779	4	1
β-strand	782-784	3	1
α-helix	786-790	5
α-helix	795-811	17
α-helix	815-826	12
β-strand	829-831	3	2
α-helix	838-857	20
α-helix	863-898	36
α-helix	910-914	5
α-helix	917-920	4
β-strand	925-927	3	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2266-2269	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Progesterone receptor	A	protein	256	Homo sapiens	P06401 (AlphaFold model)
NCoR	B	protein	25

Sequence of entity 1 (A), FASTA

>2OVM_1 Progesterone receptor (chains A)
GQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLP
GFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSL
CLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIG
LRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQL
PKILAGMVKPLLFHKK

Sequence of entity 2 (B), FASTA

>2OVM_2 NCoR (chains B)
GHSFADPASNLGLEDIIRKALMGSF

Ligands and cofactors

ID	Name	Formula	Copies
AS0	4-[(11BETA,17BETA)-17-methoxy-17-(methoxymethyl)-3-oxoestra-4,9-dien-11-yl]benz…	C28 H35 N O4	1

Primary citation

A structural and in vitro characterization of asoprisnil: a selective progesterone receptor modulator. Madauss, K.P., Grygielko, E.T., Deng, S.J. et al. Mol Endocrinol (2007) 21:1066-1081. DOI 10.1210/me.2006-0524 · PubMed

Other PDB entries of the same protein (UniProt P06401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SQN 1.45 Å, Progesterone Receptor Ligand Binding Domain with bound Norethindrone
1SR7 1.46 Å, Progesterone Receptor Hormone Binding Domain with Bound Mometasone Furoate
3ZR7 1.65 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
1A28 1.8 Å, Hormone-bound human progesterone receptor ligand-binding domain
2W8Y 1.8 Å, RU486 bound to the progesterone receptor in a destabilized agonistic conformation
3ZRB 1.8 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
3G8O 1.9 Å, Progesterone Receptor with bound Pyrrolidine 1
3ZRA 1.9 Å, Structural basis for agonism and antagonism for a set of chemically related progesterone…
4APU 1.9 Å, PR X-Ray structures in agonist conformations reveal two different mechanisms for partial…
1ZUC 2.0 Å, Progesterone receptor ligand binding domain in complex with the nonsteroidal agonist…
2OVH 2.0 Å, Progesterone Receptor with Bound Asoprisnil and a Peptide from the Co-Repressor SMRT
3KBA 2.0 Å, Progesterone receptor bound to sulfonamide pyrrolidine partial agonist

Browse structure collections

About this viewer

MolViewer shows 2OVM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.