2P1T: Retinoic acid receptor RXR-alpha

Crystal structure of the ligand binding domain of the retinoid X receptor alpha in complex with 3-(2'-methoxy)-tetrahydronaphtyl cinnamic acid and a fragment of the coactivator TIF-2. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Oct 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,891
Mol. weight: 28.82 kDa
Ligands: 3TN
Released: 9 Oct 2007

Explore 2P1T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P1T contains 14 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	232-242	11
α-helix	264-284	21
α-helix	289-291	3
α-helix	294-316	23
β-strand	323-325	3	1
β-strand	331-333	3	1
α-helix	334-338	5
α-helix	343-348	6
α-helix	349-354	6
α-helix	355-359	5
α-helix	364-375	12
α-helix	386-407	22
α-helix	414-419	6
α-helix	422-442	21
α-helix	449-454	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	688-695	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor RXR-alpha	A	protein	240	Homo sapiens	P19793 (AlphaFold model)
Nuclear receptor coactivator 2 peptide	B	protein	13		Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P1T_1 Retinoic acid receptor RXR-alpha (chains A)
TSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEW
AKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGV
GAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEA
YCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT

Sequence of entity 2 (B), FASTA

>2P1T_2 Nuclear receptor coactivator 2 peptide (chains B)
KHKILHRLLQDSS

Ligands and cofactors

ID	Name	Formula	Copies
3TN	(2E)-3-[4-hydroxy-3-(3-methoxy-5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen…	C24 H28 O4	1

Primary citation

Modulators of the structural dynamics of the retinoid X receptor to reveal receptor function. Nahoum, V., Perez, E., Germain, P. et al. Proc Natl Acad Sci U S A (2007) 104:17323-17328. DOI 10.1073/pnas.0705356104 · PubMed

Other PDB entries of the same protein (UniProt P19793 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QX6 1.46 Å, Crystal structure of RXR alpha LBD bound to a synthetic agonist FN537 and a coactivator…
6LB4 1.5 Å, Crystal structure of dimeric RXR-LBD complexed with NEt-3ME and TIF2 co-activator
7A77 1.5 Å, Crystal structure of RXR alpha LBD in complexes with palmitic acid and GRIP-1 peptide
6FBQ 1.6 Å, Crystal Structure of the Human Retinoid X Receptor DNA-Binding Domain Bound to the Human…
9RMR 1.65 Å, Crystal structure of RXR alpha LBD bound to a synthetic agonist FN558 and a coactivator…
1DSZ 1.7 Å, Structure of the rxr/rar DNA-binding domain heterodimer in complex with the retinoic…
5MKU 1.78 Å, Crystal structure of the Retinoid X Receptor alpha in complex with synthetic honokiol…
4ZSH 1.8 Å, RXR LBD in complex with 9-cis-13,14-dihydroretinoic acid
6L6K 1.8 Å, Crystal structure of dimeric RXRalpha-LBD complexed with partial agonist CBt-PMN and SRC1
7UW2 1.88 Å, Crystal structure of human Retinoid X receptor alpha ligand binding domain complex with…
6STI 1.89 Å, Crystal structure of RXRalpha LBD in complex with LG 100754 and a coactivator peptide
1MV9 1.9 Å, Crystal Structure of the human RXR alpha ligand binding domain bound to the eicosanoid…

Browse structure collections

About this viewer

MolViewer shows 2P1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.