Structure and sodium channel activity of an excitatory I1-superfamily conotoxin. Determined by solution NMR. Released 25 Sept 2007.
Explore 2P4L in 3D Show helices and sheets RCSB PDB PDBe
2P4L contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| β-strand | 18 | 1 | 1 |
| β-strand | 21-22 | 2 | 2 |
| β-strand | 27-28 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| I-superfamily conotoxin r11a | A | protein | 46 | Conus radiatus | Q7Z094 (AlphaFold model) |
>2P4L_1 I-superfamily conotoxin r11a (chains A) GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI
Structure and Sodium Channel Activity of an Excitatory I(1)-Superfamily Conotoxin. Buczek, O., Wei, D., Babon, J.J. et al. Biochemistry (2007) 46:9929-9940. DOI 10.1021/bi700797f · PubMed
Other PDB entries of the same protein (UniProt Q7Z094 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2P4L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.