2P63: Cell division control protein 4

Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination. Determined by X-ray diffraction at 2.67 Å resolution. Released 19 Jun 2007.

Method: X-ray diffraction
Resolution: 2.67 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 1,742
Mol. weight: 25.72 kDa
Released: 19 Jun 2007

Explore 2P63 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P63 contains 15 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	228-234	7
α-helix	235-237	3
α-helix	242-253	12
α-helix	256-271	16

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	228-235	8
α-helix	240-242	3
α-helix	246-253	8
α-helix	256-269	14

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	228-236	9
α-helix	242-252	11
α-helix	256-270	15

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	228-236	9
α-helix	240-243	4
α-helix	246-252	7
α-helix	256-271	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell division control protein 4	A, B, C, D	protein	56	Saccharomyces cerevisiae	P07834 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2P63_1 Cell division control protein 4 (chains A, B, C, D)
GAMGSPEYLSDEIFSAINNNLPHAYFKNLLFRLVANMDRSELSDLGTLIKDNLKRD

Primary citation

Suprafacial orientation of the SCFCdc4 dimer accommodates multiple geometries for substrate ubiquitination. Tang, X., Orlicky, S., Lin, Z. et al. Cell (2007) 129:1165-1176. DOI 10.1016/j.cell.2007.04.042 · PubMed

Other PDB entries of the same protein (UniProt P07834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V7D 2.31 Å, Crystal Structure of ScSkp1-ScCdc4-pSic1 peptide complex
3MKS 2.6 Å, Crystal Structure of yeast Cdc4/Skp1 in complex with an allosteric inhibitor SCF-I2
1NEX 2.7 Å, Crystal Structure of ScSkp1-ScCdc4-CPD peptide complex

Browse structure collections

About this viewer

MolViewer shows 2P63 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.