2PIE: FHA domain of RNF8

Crystal structure of the FHA domain of RNF8 in complex with its optimal phosphopeptide. Determined by X-ray diffraction at 1.35 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,429
Mol. weight: 16.81 kDa
Released: 11 Dec 2007

Explore 2PIE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PIE contains 7 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
β-strand	16-22	7	1
β-strand	29	1	2
β-strand	30-32	3	1
β-strand	38-41	4	3
β-strand	48-49	2	3
β-strand	64-68	5	3
β-strand	74-78	5	3
β-strand	85-87	3	1
β-strand	91	1	1
α-helix	92-93	2
β-strand	98-99	2	3
β-strand	105-108	4	1
α-helix	111-112	2
β-strand	120-128	9	1
α-helix	129-132	4
α-helix	133-135	3
β-strand	136	1	2
α-helix	137-139	3

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF8	A	protein	138	Homo sapiens	O76064 (AlphaFold model)
phosphopeptide	F	protein	7

Sequence of entity 1 (A), FASTA

>2PIE_1 E3 ubiquitin-protein ligase RNF8 (chains A)
GAHMAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQ
NPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEED
WETIYPCLSPKNDQMIEK

Sequence of entity 2 (F), FASTA

>2PIE_2 phosphopeptide (chains F)
ELKTERY

Primary citation

RNF8 Transduces the DNA-Damage Signal via Histone Ubiquitylation and Checkpoint Protein Assembly. Huen, M.S., Grant, R., Manke, I. et al. Cell (2007) 131:901-914. DOI 10.1016/j.cell.2007.09.041 · PubMed

Other PDB entries of the same protein (UniProt O76064 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4AYC 1.9 Å, RNF8 RING domain structure
4ORH 4.8 Å, Crystal structure of RNF8 bound to the UBC13/MMS2 heterodimer
4WHV 8.3 Å, E3 ubiquitin-protein ligase RNF8 in complex with Ubiquitin-conjugating enzyme E2 N and…
2CSW Solution structure of the FHA domain of human ubiquitin ligase protein RNF8

Browse structure collections

About this viewer

MolViewer shows 2PIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.