Crystal Structure of the leucine zipper domain of small-conductance Ca2+-activated K+ (SKCa) channel from Rattus norvegicus. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Apr 2008.
Explore 2PNV in 3D Show helices and sheets RCSB PDB PDBe
2PNV contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 489-523 | 35 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 489-522 | 34 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small conductance calcium-activated potassium channel protein 2 | A, B | protein | 43 | Rattus norvegicus | P70604 (AlphaFold model) |
>2PNV_1 Small conductance calcium-activated potassium channel protein 2 (chains A, B) GSHMNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALP
Crystal structure of the leucine zipper domain of small-conductance Ca2+-activated K+ (SK(Ca)) channel from Rattus norvegicus. Kim, J.Y., Kim, M.K., Kang, G.B. et al. Proteins (2008) 70:568-571. DOI 10.1002/prot.21634 · PubMed
Other PDB entries of the same protein (UniProt P70604 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2PNV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.