Crystal structure of murine thrombin in complex with the extracellular fragment of murine PAR3. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Jul 2007.
Explore 2PUX in 3D Show helices and sheets RCSB PDB PDBe
2PUX contains 17 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1J-1G | 4 | |
| α-helix | 1C-1A | 3 | |
| α-helix | 8-10 | 3 | |
| α-helix | 14C-14K | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 39-46 | 8 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-60A | 2 | 4 |
| α-helix | 60B-60D | 3 | |
| β-strand | 60F-60G | 2 | 4 |
| β-strand | 64-68 | 5 | 3 |
| β-strand | 72 | 1 | 5 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 95 | 1 | 6 |
| β-strand | 100 | 1 | 6 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 7 |
| β-strand | 118 | 1 | 7 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-124 | 2 | |
| α-helix | 126-129C | 7 | |
| β-strand | 135-140 | 6 | 2 |
| α-helix | 149C-150 | 4 | |
| β-strand | 154 | 1 | 5 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-202 | 5 | 2 |
| β-strand | 207-215 | 9 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-244 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 48-49 | 2 | |
| α-helix | 52-54 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thrombin light chain | A | protein | 44 | Mus musculus | P19221 (AlphaFold model) |
| Thrombin heavy chain | B | protein | 258 | Mus musculus | P19221 (AlphaFold model) |
| Proteinase-activated receptor 3 | C | protein | 13 | O08675 (AlphaFold model) |
>2PUX_1 Thrombin light chain (chains A) FHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR
>2PUX_2 Thrombin heavy chain (chains B) IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR ITDNMFCAGFKVNDTKRGDACEGDAGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFY THVFRLKRWIQKVIDQFG
>2PUX_3 Proteinase-activated receptor 3 (chains C) QNTFEEFPLSDIE
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Crystal structures of murine thrombin in complex with the extracellular fragments of murine protease-activated receptors PAR3 and PAR4. Bah, A., Chen, Z., Bush-Pelc, L.A. et al. Proc Natl Acad Sci U S A (2007) 104:11603-11608. DOI 10.1073/pnas.0704409104 · PubMed
Other PDB entries of the same protein (UniProt P19221 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2PUX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.