2PUY: BHC80 PHD finger

Crystal Structure of the BHC80 PHD finger. Determined by X-ray diffraction at 1.43 Å resolution. Released 14 Aug 2007.

Method: X-ray diffraction
Resolution: 1.43 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,166
Mol. weight: 15.43 kDa
Ligands: ZN
Released: 14 Aug 2007

Explore 2PUY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PUY contains 8 α-helices and 5 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	501-502	2	1
α-helix	503	1
β-strand	509-510	2	1
α-helix	512-514	3
α-helix	522-524	3
α-helix	530-538	9

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	498-502	5	2
α-helix	503	1
β-strand	509-510	2	2
α-helix	512-514	3
α-helix	518-519	2
α-helix	530-542	13

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-6	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 21A	A, B	protein	60	Homo sapiens	Q96BD5 (AlphaFold model)
Histone H3	E	protein	10		Q6NXT2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2PUY_1 PHD finger protein 21A (chains A, B)
HMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAI

Sequence of entity 2 (E), FASTA

>2PUY_2 Histone H3 (chains E)
ARTKQTARKS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression. Lan, F., Collins, R.E., De Cegli, R. et al. Nature (2007) 448:718-722. DOI 10.1038/nature06034 · PubMed

Other PDB entries of the same protein (UniProt Q96BD5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YQL Solution structure of the PHD domain in PHD finger protein 21A

Browse structure collections

About this viewer

MolViewer shows 2PUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.