2PWO: HIV-1 CA146 A92E Psuedo Cell

Crystal Structure of HIV-1 CA146 A92E Psuedo Cell. Determined by X-ray diffraction at 1.45 Å resolution. Released 25 Sept 2007.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Human immunodeficiency virus 1
Chains: 4
Atoms: 5,361
Mol. weight: 65.19 kDa
Released: 25 Sept 2007

Explore 2PWO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PWO contains 39 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	10-11	2	1
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-56	8
α-helix	63-83	21
α-helix	95-99	5
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-141	16
α-helix	142-144	3

Chain B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	2
β-strand	10-12	3	2
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	97-99	3
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-142	17

Chain C: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	3
β-strand	10-12	3	3
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-57	9
α-helix	63-83	21
α-helix	97-100	4
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-141	16
α-helix	142-144	3

Chain D: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	4
β-strand	10-12	3	4
α-helix	14-16	3
α-helix	17-30	14
α-helix	36-43	8
α-helix	49-56	8
α-helix	63-83	21
α-helix	95-99	5
α-helix	101-104	4
α-helix	111-118	8
α-helix	126-141	16
α-helix	142-144	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gag-Pol polyprotein (Pr160Gag-Pol)	A, B, C, D	protein	146	Human immunodeficiency virus 1	P12497

Sequence of entity 1 (A, B, C, D), FASTA

>2PWO_1 Gag-Pol polyprotein (Pr160Gag-Pol) (chains A, B, C, D)
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVG
GHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTH
NPPIPVGEIYKRWIILGLNKIVRMYS

Primary citation

Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein. Kelly, B.N., Kyere, S., Kinde, I. et al. J Mol Biol (2007) 373:355-366. DOI 10.1016/j.jmb.2007.07.070 · PubMed

Other PDB entries of the same protein (UniProt P12497), best resolution first:

3DS4 1.12 Å, HIV-1 capsid C-terminal domain mutant (L211S) in complex with an inhibitor of particle…
3DS2 1.2 Å, HIV-1 capsid C-terminal domain mutant (Y169A)
6T6E 1.3 Å, Crystal Structure of the C-terminal domain of the HIV-1 Integrase (PNL4-3)
2XDE 1.4 Å, Crystal structure of the complex of PF-3450074 with an engineered HIV capsid N terminal…
3L3U 1.4 Å, Crystal structure of the HIV-1 integrase core domain to 1.4A
3WNF 1.45 Å, Cyclic hexapeptide CKIDNC in complex with HIV-1 integrase
6OYD 1.46 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-004
6MCR 1.48 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-001
2PXR 1.5 Å, Crystal Structure of HIV-1 CA146 in the Presence of CAP-1
3WNH 1.5 Å, Cyclic hexapeptide PKZDNv in complex with HIV-1 integrase
4NX4 1.5 Å, Re-refinement of CAP-1 HIV-CA complex
6MCS 1.52 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-003

Browse structure collections

About this viewer

MolViewer shows 2PWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.