Minimal human CFTR first nucleotide binding domain as a monomer. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Oct 2007.
Explore 2PZG in 3D Show helices and sheets RCSB PDB PDBe
2PZG contains 28 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392-399 | 8 | 1 |
| β-strand | 441 | 1 | 1 |
| β-strand | 442 | 1 | 2 |
| β-strand | 443-448 | 6 | 1 |
| β-strand | 453-457 | 5 | 2 |
| α-helix | 464-471 | 8 | |
| β-strand | 479-484 | 6 | 1 |
| β-strand | 486 | 1 | 3 |
| β-strand | 488-491 | 4 | 2 |
| β-strand | 500-501 | 2 | 4 |
| α-helix | 502-507 | 6 | |
| α-helix | 511-512 | 2 | |
| α-helix | 514-523 | 10 | |
| α-helix | 527-531 | 5 | |
| α-helix | 536-538 | 3 | |
| α-helix | 539 | 1 | |
| β-strand | 540-541 | 2 | 4 |
| α-helix | 542 | 1 | |
| α-helix | 550-563 | 14 | |
| β-strand | 568-572 | 5 | 2 |
| α-helix | 580-586 | 7 | |
| α-helix | 587-594 | 8 | |
| β-strand | 600-603 | 4 | 2 |
| α-helix | 607-612 | 6 | |
| β-strand | 615-620 | 6 | 2 |
| β-strand | 623-628 | 6 | 2 |
| α-helix | 630-634 | 5 | |
| α-helix | 640-644 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392-399 | 8 | 5 |
| α-helix | 438-439 | 2 | |
| β-strand | 441 | 1 | 5 |
| β-strand | 442 | 1 | 6 |
| β-strand | 443-448 | 6 | 5 |
| β-strand | 453-457 | 5 | 6 |
| α-helix | 464-471 | 8 | |
| β-strand | 477-483 | 7 | 5 |
| β-strand | 486 | 1 | 3 |
| β-strand | 488-491 | 4 | 6 |
| β-strand | 500-501 | 2 | 7 |
| α-helix | 502-507 | 6 | |
| α-helix | 511-512 | 2 | |
| α-helix | 514-523 | 10 | |
| α-helix | 527-530 | 4 | |
| α-helix | 536-538 | 3 | |
| α-helix | 539 | 1 | |
| β-strand | 540-541 | 2 | 7 |
| α-helix | 547-549 | 3 | |
| α-helix | 550-563 | 14 | |
| β-strand | 568-572 | 5 | 6 |
| α-helix | 580-586 | 7 | |
| α-helix | 587-594 | 8 | |
| β-strand | 599-603 | 5 | 6 |
| α-helix | 607-612 | 6 | |
| β-strand | 615-620 | 6 | 6 |
| β-strand | 623-628 | 6 | 6 |
| α-helix | 630-634 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cystic fibrosis transmembrane conductance regulator | A, B | protein | 241 | Homo sapiens | P13569 (AlphaFold model) |
>2PZG_1 Cystic fibrosis transmembrane conductance regulator (chains A, B) SLQKQEYKTLEYNLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKT SLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQ LEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKE IFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLM G
Water and common crystallization additives (GOL) are not listed.
Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant. Atwell, S., Brouillette, C.G., Conners, K. et al. Protein Eng Des Sel (2010) 23:375-384. DOI 10.1093/protein/gzq004 · PubMed
Other PDB entries of the same protein (UniProt P13569 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2PZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.