2PZG: PDB entry 2PZG

Minimal human CFTR first nucleotide binding domain as a monomer. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Oct 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,694
Mol. weight: 55.47 kDa
Ligands: ATP, MG
Released: 9 Oct 2007

Explore 2PZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PZG contains 28 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	392-399	8	1
β-strand	441	1	1
β-strand	442	1	2
β-strand	443-448	6	1
β-strand	453-457	5	2
α-helix	464-471	8
β-strand	479-484	6	1
β-strand	486	1	3
β-strand	488-491	4	2
β-strand	500-501	2	4
α-helix	502-507	6
α-helix	511-512	2
α-helix	514-523	10
α-helix	527-531	5
α-helix	536-538	3
α-helix	539	1
β-strand	540-541	2	4
α-helix	542	1
α-helix	550-563	14
β-strand	568-572	5	2
α-helix	580-586	7
α-helix	587-594	8
β-strand	600-603	4	2
α-helix	607-612	6
β-strand	615-620	6	2
β-strand	623-628	6	2
α-helix	630-634	5
α-helix	640-644	5

Chain B: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	392-399	8	5
α-helix	438-439	2
β-strand	441	1	5
β-strand	442	1	6
β-strand	443-448	6	5
β-strand	453-457	5	6
α-helix	464-471	8
β-strand	477-483	7	5
β-strand	486	1	3
β-strand	488-491	4	6
β-strand	500-501	2	7
α-helix	502-507	6
α-helix	511-512	2
α-helix	514-523	10
α-helix	527-530	4
α-helix	536-538	3
α-helix	539	1
β-strand	540-541	2	7
α-helix	547-549	3
α-helix	550-563	14
β-strand	568-572	5	6
α-helix	580-586	7
α-helix	587-594	8
β-strand	599-603	5	6
α-helix	607-612	6
β-strand	615-620	6	6
β-strand	623-628	6	6
α-helix	630-634	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cystic fibrosis transmembrane conductance regulator	A, B	protein	241	Homo sapiens	P13569 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2PZG_1 Cystic fibrosis transmembrane conductance regulator (chains A, B)
SLQKQEYKTLEYNLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKT
SLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQ
LEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKE
IFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLM
G

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant. Atwell, S., Brouillette, C.G., Conners, K. et al. Protein Eng Des Sel (2010) 23:375-384. DOI 10.1093/protein/gzq004 · PubMed

Other PDB entries of the same protein (UniProt P13569 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PZE 1.7 Å, Minimal human CFTR first nucleotide binding domain as a head-to-tail dimer
7QI1 1.76 Å, Crystal structure of human 14-3-3 protein beta in complex with CFTR peptide pS753pS768…
5TFJ 1.85 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
6WBS 1.86 Å, Human CFTR first nucleotide binding domain with dF508/V510D
6HEP 1.86 Å, Crystal structure of human 14-3-3 beta in complex with CFTR R-domain peptide pS753-pS768
5TF8 1.86 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFA 1.87 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFB 1.87 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFD 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFF 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFI 1.89 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…
5TFG 1.91 Å, Nucleotide-binding domain 1 of the human cystic fibrosis transmembrane conductance…

Browse structure collections

About this viewer

MolViewer shows 2PZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.