2Q57: Cerulean Green fluorescent protein

Name: PDB 2Q57: X-ray structure of Cerulean GFP: A tryptophan-based chromophore useful for fluorescence lifetime imaging
Published: 2007-11-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

X-ray structure of Cerulean GFP: A tryptophan-based chromophore useful for fluorescence lifetime imaging. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Nov 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Aequorea victoria
Chains: 1
Atoms: 1,938
Mol. weight: 28.7 kDa
Released: 27 Nov 2007

Explore 2Q57 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q57 contains 6 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	11-22	12	1
β-strand	25-36	12	1
β-strand	41-48	8	1
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	1
α-helix	76-81	6
α-helix	83-86	4
β-strand	92-100	9	1
β-strand	105-115	11	1
β-strand	118-128	11	1
β-strand	141	1	2
β-strand	147-155	9	1
β-strand	160-170	11	1
β-strand	171	1	2
β-strand	176-187	12	1
α-helix	194-197	4
β-strand	199-208	10	1
β-strand	217-227	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cerulean Green fluorescent protein	A	protein	254	Aequorea victoria	P42212 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Q57_1 Cerulean Green fluorescent protein (chains A)
MRGSHHHHHHGLALPVATMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLKFICTTGKLPVPWPTLVTTLXVQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISDNVYITADKQKNGIKAN
FKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFV
TAAGITLGMDELYK

Primary citation

X-ray structure of Cerulean GFP: a tryptophan-based chromophore useful for fluorescence lifetime imaging. Malo, G.D., Pouwels, L.J., Wang, M. et al. Biochemistry (2007) 46:9865-9873. DOI 10.1021/bi602664c · PubMed

Other PDB entries of the same protein (UniProt P42212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L27 0.77 Å, X-ray crystal structure of the mutant green fluorescent protein
6JGJ 0.78 Å, Crystal structure of the F99S/M153T/V163A/E222Q variant of GFP at 0.78 A
6KL0 0.8 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 7.0
6JGI 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of GFP at 0.85 A
6KL1 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of non-deuterated GFP at pD 8.5
2WUR 0.9 Å, Atomic resolution structure of GFP measured on a rotating anode
6KKZ 0.9 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 8.5
6JGH 0.94 Å, Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A
4AS8 1.02 Å, X-ray structure of the cyan fluorescent protein Cerulean cryoprotected with ethylene…
5OXC 1.02 Å, Structure of Cerulean Fluorescent Protein at 1.02 Angstrom resolution
7PCA 1.05 Å, Functional and structural characterization of redox sensitive superfolder green…
4GF6 1.1 Å, crystal structure of GFP with cuprum bound at the Incorporated metal Chelating Amino…

Browse more

2Q57 is part of these collections:

Fluorescent and glowing proteins

About this viewer

MolViewer shows 2Q57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.