2Q7N: Leukemia inhibitory factor

Crystal structure of Leukemia inhibitory factor in complex with LIF receptor (domains 1-5). Determined by X-ray diffraction at 4.0 Å resolution. Released 31 Jul 2007.

Method: X-ray diffraction
Resolution: 4.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 10,839
Mol. weight: 158.38 kDa
Ligands: NAG
Released: 31 Jul 2007

Explore 2Q7N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q7N contains 32 α-helices and 104 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 51 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
β-strand	17-21	5	2
β-strand	33-40	8	3
β-strand	42-47	6	3
β-strand	52-56	5	2
β-strand	63-69	7	3
β-strand	74-79	6	3
β-strand	85-86	2	1
α-helix	88-92	5
β-strand	93-95	3	4
β-strand	98-99	2	4
β-strand	104-109	6	4
β-strand	111	1	5
α-helix	113-115	3
β-strand	120-121	2	6
β-strand	122-127	6	7
β-strand	140-141	2	7
β-strand	144-145	2	6
α-helix	146	1
β-strand	151	1	5
β-strand	154-158	5	4
β-strand	169-170	2	8
β-strand	171-176	6	7
β-strand	185	1	1
α-helix	190-193	4
β-strand	194-195	2	8
β-strand	206-207	2	9
β-strand	212-214	3	10
β-strand	220-223	4	9
β-strand	229-234	6	11
β-strand	237-238	2	11
β-strand	242-243	2	9
β-strand	249-252	4	9
β-strand	264-270	7	11
β-strand	274-279	6	11
β-strand	280-282	3	10
α-helix	283-286	4
β-strand	292-294	3	12
β-strand	295	1	13
β-strand	300-305	6	12
β-strand	320-325	6	14
β-strand	331-335	5	14
α-helix	339-340	2
β-strand	345-350	6	12
β-strand	359-366	8	14
β-strand	369-376	8	14
α-helix	379-381	3
β-strand	383	1	13
β-strand	389-395	7	15
β-strand	401-410	10	15
β-strand	415-422	8	16
β-strand	423	1	17
α-helix	424	1
β-strand	430-437	8	16
β-strand	440-448	9	15
β-strand	457	1	18
β-strand	458	1	17
β-strand	461-465	5	16
β-strand	480	1	18

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	23-47	25
α-helix	56-59	4
α-helix	67-69	3
α-helix	76-104	29
α-helix	109-132	24
α-helix	155-179	25

Chain C: 13 helices, 51 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	19
β-strand	17-21	5	19
α-helix	23-24	2
β-strand	33-38	6	20
β-strand	44-47	4	20
β-strand	52-56	5	19
α-helix	57-59	3
β-strand	63-65	3	21
β-strand	66-67	2	20
β-strand	68	1	22
β-strand	69	1	20
β-strand	74	1	22
β-strand	77-79	3	21
α-helix	81-83	3
β-strand	84-86	3	19
β-strand	95-97	3	23
β-strand	104-108	5	23
β-strand	111	1	24
α-helix	113-115	3
β-strand	121-129	9	25
β-strand	138-144	7	25
β-strand	151	1	24
β-strand	156-158	3	23
β-strand	168	1	26
β-strand	169-176	8	25
β-strand	184-185	2	19
α-helix	189-193	5
β-strand	196	1	26
α-helix	198-200	3
β-strand	206-207	2	27
β-strand	212-214	3	28
β-strand	219-223	5	27
β-strand	231-234	4	29
β-strand	237-239	3	29
β-strand	250-253	4	27
β-strand	264-269	6	29
β-strand	274-279	6	29
β-strand	280-282	3	28
α-helix	283-286	4
β-strand	292-294	3	30
β-strand	295	1	31
β-strand	300-304	5	30
β-strand	305	1	32
α-helix	315-317	3
β-strand	322-325	4	33
β-strand	331-333	3	33
α-helix	339-340	2
α-helix	344	1
β-strand	345	1	32
α-helix	346	1
β-strand	348-350	3	30
β-strand	357-366	10	33
β-strand	369-378	10	33
β-strand	383	1	31
β-strand	389-395	7	34
β-strand	401-410	10	34
β-strand	415-423	9	35
α-helix	428-429	2
β-strand	430-437	8	35
β-strand	440-448	9	34
β-strand	457-465	9	35
β-strand	468	1	35
α-helix	471-477	7
β-strand	478-480	3	35

Chain D: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	36
α-helix	23-48	26
α-helix	68-69	2
α-helix	76-104	29
α-helix	109-133	25
β-strand	141	1	36
α-helix	155-177	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukemia inhibitory factor receptor	A, C	protein	488	Mus musculus	P42703 (AlphaFold model)
Leukemia inhibitory factor	B, D	protein	180	Homo sapiens	P15018 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2Q7N_1 Leukemia inhibitory factor receptor (chains A, C)
DYKDDDDKDLKCTTNNMRVWDCTWPAPLGVSPGTVKDICIKDRFHSCHPLETTNVKIPAL
SPGDHEVTINYLNGFQSKFTLNEKDVSLIPETPEILDLSADFFTSSLLLKWNDRGSALPH
PSNATWEIKVLQNPRTEPVALVLLNTMLSGKDTVQHWNWTSDLPLQCATHSVSIRWHIDS
PHFSGYKEWSDWSPLKNISWIRNTETNVFPQDKVVLAGSNMTICCMSPTKVLSGQIGNTL
RPLIHLYGQTVAIHILNIPVSENSGTNIIFITDDDVYGTVVFAGYPPDVPQKLSCETHDL
KEIICSWNPGRITGLVGPRNTEYTLFESISGKSAVFHRIEGLTNETYRLGVQMHPGQEIH
NFTLTGRNPLGQAQSAVVINVTERVAPHDPTSLKVKDINSTVVTFSWYLPGNFTKINLLC
QIEICKANSKKEVRNATIRGAEDSTYHVAVDKLNPYTAYTFRVRCSSKTFWKWSRWSDEK
RHLTTEAT

Sequence of entity 2 (B, D), FASTA

>2Q7N_2 Leukemia inhibitory factor (chains B, D)
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLC
GPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATAD
ILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

An unusual cytokine:Ig-domain interaction revealed in the crystal structure of leukemia inhibitory factor (LIF) in complex with the LIF receptor. Huyton, T., Zhang, J.G., Luo, C.S. et al. Proc Natl Acad Sci U S A (2007) 104:12737-12742. DOI 10.1073/pnas.0705577104 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2Q7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.