2QJ0: Yeast U-box-containing ubiquitin ligase Ufd2p

Name: PDB 2QJ0: Structure of the yeast U-box-containing ubiquitin ligase Ufd2p
Published: 2007-09-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Structure of the yeast U-box-containing ubiquitin ligase Ufd2p. Determined by X-ray diffraction at 2.65 Å resolution. Released 18 Sept 2007.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 7,661
Mol. weight: 113.21 kDa
Released: 18 Sept 2007

Explore 2QJ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QJ0 contains 50 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 50 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	-2-8	11
β-strand	10-11	2	1
α-helix	20	1
β-strand	21-22	2	1
α-helix	23	1
α-helix	39-48	10
α-helix	56-74	19
α-helix	82-101	20
α-helix	113-122	10
α-helix	124-126	3
α-helix	128-140	13
α-helix	145-161	17
α-helix	171-185	15
α-helix	188-194	7
α-helix	218-221	4
α-helix	228-234	7
α-helix	243-274	32
α-helix	276-291	16
α-helix	294-297	4
α-helix	303-305	3
α-helix	309-323	15
α-helix	339-343	5
β-strand	356	1	2
β-strand	359	1	2
α-helix	361-369	9
α-helix	381-392	12
α-helix	393-397	5
α-helix	398-405	8
α-helix	407-421	15
α-helix	429-460	32
α-helix	463-484	22
α-helix	511-517	7
α-helix	523-525	3
β-strand	527	1	2
α-helix	529-541	13
α-helix	555-567	13
α-helix	575-587	13
α-helix	591-592	2
α-helix	601-606	6
α-helix	608-624	17
α-helix	636-654	19
α-helix	656-668	13
α-helix	670-703	34
α-helix	720-754	35
α-helix	756-760	5
α-helix	762-780	19
α-helix	782-785	4
α-helix	792-795	4
α-helix	799-813	15
α-helix	817-825	9
α-helix	832-840	9
α-helix	852-878	27
α-helix	883-885	3
β-strand	886	1	3
β-strand	893	1	3
β-strand	897-899	3	4
β-strand	906-908	3	4
α-helix	909-916	8
β-strand	921	1	5
β-strand	928	1	5
β-strand	935-936	2	4
α-helix	938-946	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin conjugation factor E4	A	protein	982	Saccharomyces cerevisiae	P54860 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2QJ0_1 Ubiquitin conjugation factor E4 (chains A)
GSHMASMTGGQQMGRGSEFRSMTAIEDILQITTDPSDTRGYSLLKSEEVPQGSTLGVDFI
DTLLLYQLTENEKLDKPFEYLNDCFRRNQQQKRITKNKPNAESLHSTFQEIDRLVIGYGV
VALQIENFCMNGAFINYITGIVSNVNSYTDFLSQIIQRAILEGTALDLLNAVFPTLLEYC
NKHVSHFDLNESVIYNNVLTIFELFVTFKPIAEIFTKIDGFFADYSCKPQDFERKTILGP
ILSLSPIEAAVAIRNYGDNLLRSKQQTAMIHESLQAEHKVVIDRLFFIVDKLVRGSLNSR
TDMISYFAHIANKNHLRRADHPPFKELSSNGFMSNITLLLVRFSQPFLDISYKKIDKIDA
NYFNNPSLFIDLSGETRLNSDFKEADAFYDKNRKTADSKPNFISDCFFLTLTYLHYGLGG
TLSFEEKMGSEIKALKEEIEKVKKIAANHDVFARFITAQLSKMEKALKTTESLRFALQGF
FAHRSLQLEVFDFICGASTFLIRVVDPEHEFPFKQIKLPLIPDQIGVENVDNADFLRAHA
PVPFKYYPEFVVEGPVNYSLYISKYQTSPIFRNPRLGSFVEFTTMVLRCPELVSNPHLKG
KLVQLLSVGAMPLTDNSPGFMMDIFEHDELVNKNLLYALLDFYVIVEKTGSSSQFYDKFN
SRYSISIILEELYYKIPSYKNQLIWQSQNNADFFVRFVARMLNDLTFLLDEGLSNLAEVH
NIQNELDNRARGAPPTREEEDKELQTRLASASRQAKSSCGLADKSMKLFEIYSKDIPAAF
VTPEIVYRLASMLNYNLESLVGPKCGELKVKDPQSYSFNPKDLLKALTTVYINLSEQSEF
ISAVAKDERSFNRNLFVRAVDILGRKTGLASPEFIEKLLNFANKAEEQRKADEEEDLEYG
DVPDEFLDPLMYTIMKDPVILPASKMNIDRSTIKAHLLSDSTDPFNRMPLKLEDVTPNEE
LRQKILCFKKQKKEEAKHKASE

Primary citation

Inaugural Article: Structure and function of the yeast U-box-containing ubiquitin ligase Ufd2p. Tu, D., Li, W., Ye, Y. et al. Proc Natl Acad Sci U S A (2007) 104:15599-15606. DOI 10.1073/pnas.0701369104 · PubMed

Other PDB entries of the same protein (UniProt P54860 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3M62 2.4 Å, Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Rad23
3M63 2.4 Å, Crystal structure of Ufd2 in complex with the ubiquitin-like (UBL) domain of Dsk2
2QIZ 2.56 Å, Structure of the yeast U-box-containing ubiquitin ligase Ufd2p
9M7O 4.14 Å, Cryo-EM structure of Ufd2/Ubc4-ub complex with K29triUb(monomeric conformation)
9KHS 4.31 Å, Cryo-EM structure of Ufd2/Ubc4-Ub in complex with K29-linked diUb (monomeric conformation)
9KHT 4.85 Å, cryo-EM structure of Ufd2/Ubc4-Ub in complex with K29-linked triUb (dimeric conformation)

Browse structure collections

About this viewer

MolViewer shows 2QJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.