2QRT: PDB entry 2QRT

Crystal Structure of a disulfide trapped single chain trimer composed of the MHC I heavy chain H-2Kb Y84C, beta-2microglobulin, and ovalbumin-derived peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 6 Nov 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 7,143
Mol. weight: 94.1 kDa
Released: 6 Nov 2007

Explore 2QRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QRT contains 23 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	2P-5P	4
α-helix	23P-2B	3
β-strand	3B	1	1
β-strand	6B-11B	6	2
β-strand	21B-30B	10	2
β-strand	31B	1	1
β-strand	36B-41B	6	3
β-strand	44B-45B	2	3
β-strand	50B-51B	2	2
α-helix	52B-54B	3
β-strand	55B-56B	2	2
β-strand	62B-70B	9	2
β-strand	78B-83B	6	3
β-strand	91B-94B	4	3
β-strand	3H-12H	10	4
α-helix	20H	1
β-strand	21H-28H	8	4
β-strand	31H-37H	7	4
β-strand	46H-47H	2	4
α-helix	50H-54H	5
α-helix	57H-84H	28
β-strand	94H-103H	10	4
β-strand	109H-118H	10	4
β-strand	121H-126H	6	4
β-strand	133H-135H	3	4
α-helix	138H-150H	13
α-helix	152H-158H	7
α-helix	159H-163H	5
α-helix	164H-180H	17
β-strand	183H	1	5
β-strand	186H-193H	8	6
β-strand	198H-208H	11	6
β-strand	209H	1	5
β-strand	214H-219H	6	7
β-strand	222H-223H	2	7
β-strand	229H-230H	2	6
β-strand	234H-235H	2	6
β-strand	241H-250H	10	6
α-helix	254H-256H	3
β-strand	257H-262H	6	7
β-strand	270H-272H	3	7

Chain B: 12 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	2P-5P	4
α-helix	22P-1B	3
β-strand	3B	1	8
β-strand	6B-11B	6	9
β-strand	21B-30B	10	9
β-strand	31B	1	8
β-strand	36B-41B	6	10
β-strand	44B-45B	2	10
α-helix	46B	1
β-strand	50B-51B	2	9
α-helix	52B-54B	3
β-strand	55B-56B	2	9
β-strand	62B-70B	9	9
β-strand	78B-83B	6	10
β-strand	91B-94B	4	10
β-strand	3H-12H	10	11
α-helix	20H	1
β-strand	21H-28H	8	11
β-strand	31H-37H	7	11
β-strand	46H-47H	2	11
α-helix	50H-54H	5
α-helix	57H-84H	28
β-strand	94H-103H	10	11
β-strand	109H-118H	10	11
β-strand	121H-126H	6	11
β-strand	133H-135H	3	11
α-helix	138H-150H	13
α-helix	152H-158H	7
α-helix	159H-163H	5
α-helix	164H-175H	12
β-strand	183H	1	12
β-strand	186H-193H	8	13
β-strand	198H-208H	11	13
β-strand	209H	1	12
β-strand	214H-219H	6	14
β-strand	222H-223H	2	14
β-strand	229H-230H	2	13
β-strand	234H-235H	2	13
β-strand	241H-250H	10	13
α-helix	254H-256H	3
β-strand	257H-262H	6	14
β-strand	270H-272H	3	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class I histocompatibility antigen K-B alpha chain, Beta-2 microglobulin, ovalbumin-derived…	A, B	protein	422	Mus musculus	P01887 (AlphaFold model), P01901 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QRT_1 H-2 class I histocompatibility antigen K-B alpha chain, Beta-2 microglobulin, ovalbumin-derived peptide (chains A, B)
SIINFEKLGCGASGGGGSGGGGSIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEI
QMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDR
DMGGGGSGGGGSGGGGSGGGGSGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDS
DAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGCYNQSKGGSHTIQVI
SGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRA
YLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQ
LNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
ST

Primary citation

Structural engineering of pMHC reagents for T cell vaccines and diagnostics. Mitaksov, V., Truscott, S.M., Lybarger, L. et al. Chem Biol (2007) 14:909-922. DOI 10.1016/j.chembiol.2007.07.010 · PubMed

Other PDB entries of the same protein (UniProt P01887 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
1G7P 1.5 Å, Crystal structure of MHC class I H-2KB heavy chain complexed with beta-2 microglobulin…
1KPU 1.5 Å, High resolution crystal structure of the MHC class I complex H-2Kb/VSV8
5WEU 1.58 Å, Crystal Structure of H2-Dd with disulfide-linked 10mer peptide
1G7Q 1.6 Å, Crystal structure of MHC class I H-2KB heavy chain complexed with beta-2 microglobulin…
3G08 1.6 Å, Crystal structure of the alpha-galactosylceramide analog OCH in complex with mouse CD1d
3GMO 1.6 Å, Structure of mouse CD1d in complex with C8PhF
7LFK 1.6 Å, Model of MHC class ib H2-M3 with mouse ND1 N-terminal heptapeptide, thr mutant, refined…
7LFL 1.6 Å, Model of MHC class ib H2-M3 with mouse ND1 N-terminal heptapeptide, val mutant,…
7LFM 1.6 Å, Model of MHC class ib H2-M3 with mouse ND1 N-terminal heptapeptide, val mutant,…
6C6F 1.67 Å, Structure of glycolipid aGSA[26,P5p] in complex with mouse CD1d
3ECB 1.7 Å, Crystal structure of mouse H-2Dd in complex with peptide P18-I10 derived from human…

Browse structure collections

About this viewer

MolViewer shows 2QRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.