2QWL: Bovine hsc70 (1-394aa)in the ADP state

Name: PDB 2QWL: Crystal structure of bovine hsc70 (1-394aa)in the ADP state
Published: 2007-12-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of bovine hsc70 (1-394aa)in the ADP state. Determined by X-ray diffraction at 1.75 Å resolution. Released 18 Dec 2007.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Bos taurus
Chains: 2
Atoms: 6,765
Mol. weight: 87.93 kDa
Ligands: MG, ADP
Released: 18 Dec 2007

Explore 2QWL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QWL contains 41 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	15-16	2	2
β-strand	17-22	6	1
β-strand	25-28	4	1
α-helix	29-30	2
β-strand	38-39	2	2
β-strand	42-44	3	3
β-strand	49-51	3	3
α-helix	53-57	5
α-helix	59-61	3
α-helix	63-65	3
β-strand	66-67	2	3
α-helix	70-73	4
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	4
β-strand	100-107	8	4
β-strand	110-114	5	4
α-helix	116-135	20
β-strand	141-146	6	1
α-helix	152-164	13
β-strand	168-174	7	1
α-helix	175-182	8
β-strand	193-200	8	5
β-strand	205-213	9	5
β-strand	216-225	10	5
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	6
β-strand	291-298	8	6
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-324	11
α-helix	328-330	3
β-strand	333-337	5	5
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	5
α-helix	368-380	13

Chain B: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	7
β-strand	15-16	2	8
β-strand	17-22	6	7
β-strand	25-28	4	7
α-helix	29-30	2
β-strand	38-39	2	8
β-strand	42-44	3	9
β-strand	49-51	3	9
α-helix	53-57	5
α-helix	59-61	3
α-helix	63-65	3
β-strand	66-67	2	9
α-helix	70-73	4
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-97	5	10
β-strand	100-107	8	10
β-strand	110-114	5	10
α-helix	116-135	20
β-strand	141-146	6	7
α-helix	152-164	13
β-strand	168-174	7	7
α-helix	175-182	8
α-helix	185-187	3
β-strand	193-200	8	11
β-strand	205-213	9	11
β-strand	216-225	10	11
α-helix	230-249	20
α-helix	257-273	17
β-strand	279-288	10	12
β-strand	291-298	8	12
α-helix	299-305	7
α-helix	307-312	6
α-helix	314-323	10
α-helix	328-330	3
β-strand	333-337	5	11
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	11
α-helix	368-380	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock cognate 71 kDa protein	A, B	protein	394	Bos taurus	P19120 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QWL_1 Heat shock cognate 71 kDa protein (chains A, B)
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Water and common crystallization additives (NA, GOL) are not listed.

Primary citation

Structural basis of J cochaperone binding and regulation of Hsp70. Jiang, J., Maes, E.G., Taylor, A.B. et al. Mol Cell (2007) 28:422-433. DOI 10.1016/j.molcel.2007.08.022 · PubMed

Other PDB entries of the same protein (UniProt P19120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ODB 1.66 Å, Crystal structure of bovine Hsc70(aa1-554)E213A/D214A in complex with triazine-derivative
1BA1 1.7 Å, Heat-shock cognate 70KD protein 44KD atpase N-terminal mutant with cys 17 replaced by lys
1BUP 1.7 Å, T13S mutant of bovine 70 kilodalton heat shock protein
1HPM 1.7 Å, How potassium affects the activity of the molecular chaperone HSC70. II. Potassium binds…
1KAX 1.7 Å, 70KD heat shock cognate protein atpase domain, K71M mutant
1KAY 1.7 Å, 70KD heat shock cognate protein atpase domain, K71A mutant
1KAZ 1.7 Å, 70KD heat shock cognate protein atpase domain, K71E mutant
2BUP 1.7 Å, T13G Mutant of the ATPASE fragment of Bovine HSC70
2QWO 1.7 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)R171C…
2QWP 1.75 Å, Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)R171C…
7ODI 1.83 Å, Crystal structure of bovine Hsc70(aa1-554)E213A/D214A in complex with methanesulfonamide
2QW9 1.85 Å, Crystal structure of bovine hsc70 (1-394aa)in the apo state

Browse structure collections

About this viewer

MolViewer shows 2QWL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.