2QZA: Salmonella effector protein SopA

Name: PDB 2QZA: Crystal structure of Salmonella effector protein SopA
Published: 2007-12-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of Salmonella effector protein SopA. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Salmonella typhimurium
Chains: 2
Atoms: 9,441
Mol. weight: 139.05 kDa
Released: 11 Dec 2007

Explore 2QZA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QZA contains 66 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	170-184	15
α-helix	193-195	3
β-strand	196	1	1
β-strand	201	1	2
β-strand	206	1	3
α-helix	207-209	3
α-helix	213-216	4
β-strand	223-224	2	1
β-strand	227	1	1
β-strand	232	1	2
β-strand	237	1	3
β-strand	242-244	3	1
β-strand	247	1	1
β-strand	252	1	2
β-strand	257	1	3
β-strand	262-264	3	1
β-strand	267	1	1
β-strand	272-273	2	2
β-strand	284-289	6	1
β-strand	294-295	2	2
β-strand	300-305	6	1
β-strand	323-326	4	2
β-strand	329-332	4	2
α-helix	333-334	2
α-helix	339-346	8
α-helix	348-350	3
α-helix	356-361	6
α-helix	370-383	14
α-helix	393-395	3
α-helix	396-403	8
α-helix	408-410	3
α-helix	413-433	21
α-helix	437-441	5
α-helix	443-444	2
α-helix	445-449	5
α-helix	450-458	9
α-helix	463-466	4
α-helix	468-478	11
α-helix	486-501	16
α-helix	506-508	3
β-strand	531-534	4	4
α-helix	535	1
β-strand	542-545	4	4
α-helix	547-554	8
β-strand	566-568	3	4
β-strand	573-574	2	4
α-helix	581-585	5
α-helix	590-612	23
α-helix	619-627	9
α-helix	628-630	3
α-helix	642-648	7
α-helix	652-654	3
α-helix	662-665	4
α-helix	667-670	4
α-helix	679-697	19
β-strand	704	1	5
β-strand	707	1	5
α-helix	710-724	15
α-helix	728-730	3
α-helix	734-743	10
α-helix	757-766	10
α-helix	779-781	3

Chain B: 29 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	170-185	16
β-strand	196	1	6
β-strand	206	1	7
β-strand	223-224	2	6
β-strand	227	1	6
β-strand	237	1	7
β-strand	242-247	6	6
β-strand	252	1	8
β-strand	257	1	7
β-strand	262-267	6	6
β-strand	272-273	2	8
α-helix	282-283	2
β-strand	284-286	3	6
β-strand	289	1	6
β-strand	294-295	2	8
β-strand	300	1	6
α-helix	313-315	3
β-strand	323-326	4	8
β-strand	329-332	4	8
α-helix	333-334	2
α-helix	339-346	8
α-helix	356-359	4
α-helix	365-367	3
α-helix	368-383	16
α-helix	393-395	3
α-helix	396-403	8
α-helix	412-433	22
α-helix	437-439	3
α-helix	443-444	2
α-helix	445-449	5
α-helix	450-459	10
α-helix	461-466	6
α-helix	468-479	12
α-helix	486-500	15
α-helix	506-508	3
β-strand	531-532	2	9
β-strand	544-545	2	9
α-helix	582-587	6
α-helix	590-609	20
α-helix	621-628	8
α-helix	664-671	8
α-helix	679-692	14
α-helix	711-726	16
α-helix	728-730	3
α-helix	734-744	11
α-helix	755-768	14
α-helix	770-773	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Secreted effector protein	A, B	protein	618	Salmonella typhimurium	Q8ZNR3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QZA_1 Secreted effector protein (chains A, B)
SSPSSPADWAKKLTDAVLRQKAGETLTAADRDFSNADFRNITFSKILPPSFMERDGDIIK
GFNFSNSKFTYSDISHLHFDECRFTYSTLSDVVCSNTKFSNSDMNEVFLQYSITTQQQPS
FIDTTLKNTLIRHKANLSGVILNEPDNSSPPSVSGGGNFIRLGDIWLQMPLLWTENAVDG
FLNHEHNNGKSILMTIDSLPDKYSQEKVQAMEDLVKSLRGGRLTEACIRPVESSLVSVLA
HPPYTQSALISEWLGPVQERFFAHQCQTYNDVPLPAPDTYYQQRILPVLLDSFDRNSAAM
TTHSGLFNQVILHCMTGVDCTDGTRQKAAALYEQYLAHPAVSPHIHNGLFGNYDGSPDWT
TRAADNFLLLSSQDSDTAMMLSTDTLLTMLNPTPDTAWDNFYLLRAGENVSTAQISPVEL
FRHDFPVFLAAFNQQATQRRFGELIDIILSTEEHGELNQQFLAATNQKHSTVKLIDDASV
SRLATIFDPLLPEGKLSPAHYQHILSAYHLTDATPQKQAETLFCLSTAFARYSSSAIFGT
EHDSPPALRGYAEALMQKAWELSPAIFPSSEQFTEWSDRFHGLHGAFTCTSVVADSMQRH
ARKYFPSVLSSILPLAWA

Primary citation

Crystal structure of SopA, a Salmonella effector protein mimicking a eukaryotic ubiquitin ligase. Diao, J., Zhang, Y., Huibregtse, J.M. et al. Nat Struct Mol Biol (2008) 15:65-70. DOI 10.1038/nsmb1346 · PubMed

Other PDB entries of the same protein (UniProt Q8ZNR3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ST8 1.75 Å, Structure of E3 ligase SopA bound to ubiquitin
2QYU 2.1 Å, Crystal structure of Salmonella effector protein SopA
5JW7 2.85 Å, Crystal structure of SopA-Trim56 complex
3SY2 3.27 Å, Crystal structure of the Salmonella E3 ubiquitin ligase SopA in complex with the human…

Browse structure collections

About this viewer

MolViewer shows 2QZA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.