2R0O: Alpha-actinin-4

Crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(K255E). Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Feb 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,255
Mol. weight: 54.62 kDa
Released: 5 Feb 2008

Explore 2R0O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R0O contains 32 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-64	18
α-helix	65-67	3
α-helix	82-92	11
α-helix	95-100	6
α-helix	105-120	16
α-helix	131-135	5
α-helix	139-150	12
α-helix	151-155	5
β-strand	159-160	2	1
β-strand	163-164	2	1
α-helix	165-177	13
α-helix	190-192	3
α-helix	196-205	10
α-helix	207-209	3
α-helix	212-214	3
α-helix	220-234	15
α-helix	243-248	6
α-helix	254-267	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin-4	A, B	protein	237	Homo sapiens	O43707 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2R0O_1 Alpha-actinin-4 (chains A, B)
GAMDPEFAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKP
ERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDIS
VEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDD
PVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEEAIMTYVSSFYHAFSGALDELN

Primary citation

Crystal structure of the actin-binding domain of alpha-actinin-4 Lys255Glu mutant implicated in focal segmental glomerulosclerosis. Lee, S.H., Weins, A., Hayes, D.B. et al. J Mol Biol (2008) 376:317-324. DOI 10.1016/j.jmb.2007.11.084 · PubMed

Other PDB entries of the same protein (UniProt O43707 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OA6 1.37 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4
6O31 1.51 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
1WLX Solution structure of the third spectrin repeat of alpha-actinin-4

Browse structure collections

About this viewer

MolViewer shows 2R0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.