2R9A: Human XLF

Crystal structure of human XLF. Determined by X-ray diffraction at 2.5 Å resolution. Released 1 Jan 2008.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,744
Mol. weight: 53.42 kDa
Released: 1 Jan 2008

Explore 2R9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R9A contains 26 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
α-helix	11-13	3
β-strand	14-18	5	1
β-strand	21-30	10	1
β-strand	33-39	7	1
β-strand	44-50	7	1
α-helix	51-61	11
α-helix	69-80	12
β-strand	94-100	7	2
β-strand	103-112	10	2
β-strand	115-123	9	2
β-strand	124-125	2	1
α-helix	126-127	2
α-helix	128-131	4
α-helix	132-136	5
α-helix	137-165	29
α-helix	166-171	6
α-helix	180-184	5
α-helix	186-196	11
α-helix	198-201	4
α-helix	210-213	4
α-helix	215-225	11

Chain B: 12 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	12-13	2
β-strand	14-17	4	3
β-strand	22-30	9	3
β-strand	33-39	7	3
β-strand	44-50	7	3
α-helix	51-61	11
α-helix	69-78	10
β-strand	94-100	7	4
β-strand	103-112	10	4
β-strand	115-123	9	4
β-strand	124-125	2	3
α-helix	126-127	2
α-helix	128-131	4
α-helix	132-136	5
α-helix	137-169	33
α-helix	186-196	11
α-helix	198-201	4
α-helix	208-213	6
α-helix	215-226	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-homologous end-joining factor 1	A, B	protein	230	Homo sapiens	Q9H9Q4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2R9A_1 Non-homologous end-joining factor 1 (chains A, B)
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKE
LNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWN
FHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLK
TEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHHHHH

Primary citation

Crystal Structure of Human XLF: A Twist in Nonhomologous DNA End-Joining. Andres, S.N., Modesit, M., Tsai, C.J. et al. Mol Cell 28:1093-1101. DOI 10.1016/j.molcel.2007.10.024 · PubMed

Other PDB entries of the same protein (UniProt Q9H9Q4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QM4 2.3 Å, Crystal structure of human XLF/Cernunnos, a non-homologous end-joining factor
7ZYG 2.68 Å, CryoEM structure of Ku heterodimer bound to DNA, PAXX and XLF
6ERH 2.8 Å, Complex of XLF and heterodimer Ku bound to DNA
9CQ3 2.8 Å, The gap-filling complex with Pol mu engaged in the NHEJ pathway
9N81 2.8 Å, A gap-filling complex with Pol mu engaged in the NHEJ Pathway
6ERG 2.9 Å, Complex of XLF and heterodimer Ku bound to DNA
9CQ6 3.1 Å, The ligation complex in the NHEJ pathway
9N83 3.1 Å, The ligation complex in the NHEJ pathway
9N82 3.3 Å, The ligation (AMP-Lys) complex in the NHEJ pathway
9CQC 3.4 Å, The ligation complex like in the NHEJ pathway
9IOL 3.46 Å, Cryo-EM structure of the complex of DNA, Ku70/80, and laXLF.
3RWR 3.94 Å, Crystal structure of the human XRCC4-XLF complex

Browse structure collections

About this viewer

MolViewer shows 2R9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.