2RBL: High resolution design of a protein loop

High resolution design of a protein loop. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Nov 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,009
Mol. weight: 34.95 kDa
Released: 20 Nov 2007

Explore 2RBL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RBL contains 5 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	804-806	3
β-strand	807-812	6	1
β-strand	819-824	6	1
α-helix	827-829	3
β-strand	831-839	9	2
β-strand	847-852	6	2
β-strand	857-860	4	3
β-strand	868-877	10	2
β-strand	880-881	2	2
α-helix	882-884	3
β-strand	885-890	6	2

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	804-806	3
β-strand	807-812	6	3
β-strand	819-824	6	3
β-strand	831-839	9	4
β-strand	847-852	6	4
β-strand	857-860	4	1
α-helix	863-864	2
β-strand	868-877	10	4
β-strand	880-881	2	4
β-strand	885-890	6	4

Chain M: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	819-822	4	5
β-strand	832-839	8	2
β-strand	846-850	5	2
β-strand	857-860	4	5
β-strand	868-877	10	2
β-strand	880-881	2	2
β-strand	885-890	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tenascin	A, B, M	protein	104	Homo sapiens	P24821 (AlphaFold model)

Sequence of entity 1 (A, B, M), FASTA

>2RBL_1 Tenascin (chains A, B, M)
MRLDAPSQIEVKDVTDTTALITWSMQLSQLEGIELTYGIKDVPGDRTTIDLTEDENQYSI
GNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLAAALEHHHHHH

Primary citation

High-resolution design of a protein loop. Hu, X., Wang, H., Ke, H. et al. Proc Natl Acad Sci U S A (2007) 104:17668-17673. DOI 10.1073/pnas.0707977104 · PubMed

Other PDB entries of the same protein (UniProt P24821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5R61 1.38 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
9R5Y 1.4 Å, Crystal structure of the C-terminal domain of human TNC in complex with Adhiron 52
5R62 1.4 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
6QNV 1.4 Å, Fibrinogen-like globe domain of Human Tenascin-C
2RB8 1.45 Å, High resolution design of a protein loop
5R5U 1.52 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5T 1.55 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5X 1.56 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5Y 1.57 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R63 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5W 1.6 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5Z 1.67 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…

Browse structure collections

About this viewer

MolViewer shows 2RBL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.