Glutaminyl-tRNA synthetase mutant C229R with bound analog 5'-O-[N-(L-GLUTAMINYL)-SULFAMOYL]ADENOSINE. Determined by X-ray diffraction at 2.6 Å resolution. Released 15 Jan 2008.
Explore 2RD2 in 3D Show helices and sheets RCSB PDB PDBe
2RD2 contains 25 α-helices and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-21 | 12 | |
| β-strand | 28-31 | 4 | 1 |
| β-strand | 40 | 1 | 2 |
| α-helix | 41-56 | 16 | |
| β-strand | 60-63 | 4 | 1 |
| β-strand | 64-65 | 2 | 3 |
| α-helix | 70-72 | 3 | |
| α-helix | 75-88 | 14 | |
| β-strand | 97-98 | 2 | 3 |
| α-helix | 99-102 | 4 | |
| α-helix | 103-115 | 13 | |
| β-strand | 119-122 | 4 | 4 |
| α-helix | 126-133 | 8 | |
| α-helix | 150-161 | 12 | |
| β-strand | 171-174 | 4 | 4 |
| α-helix | 183-185 | 3 | |
| β-strand | 189-193 | 5 | 4 |
| β-strand | 198 | 1 | 5 |
| β-strand | 202 | 1 | 5 |
| β-strand | 207-209 | 3 | 4 |
| α-helix | 211-222 | 12 | |
| β-strand | 226-230 | 5 | 6 |
| α-helix | 231-233 | 3 | |
| α-helix | 237-246 | 10 | |
| α-helix | 253 | 1 | |
| β-strand | 254-258 | 5 | 6 |
| α-helix | 259-261 | 3 | |
| β-strand | 263 | 1 | 7 |
| α-helix | 270-278 | 9 | |
| β-strand | 292 | 1 | 2 |
| α-helix | 293-299 | 7 | |
| α-helix | 303-313 | 11 | |
| β-strand | 322 | 1 | 7 |
| α-helix | 324-338 | 15 | |
| α-helix | 339-340 | 2 | |
| β-strand | 341-342 | 2 | 8 |
| β-strand | 344-345 | 2 | 8 |
| β-strand | 348-353 | 6 | 9 |
| β-strand | 361-366 | 6 | 10 |
| α-helix | 372-374 | 3 | |
| β-strand | 376-381 | 6 | 10 |
| β-strand | 384-388 | 5 | 9 |
| α-helix | 389-391 | 3 | |
| β-strand | 392-393 | 2 | 11 |
| β-strand | 403-404 | 2 | 11 |
| β-strand | 405 | 1 | 12 |
| β-strand | 407 | 1 | 12 |
| β-strand | 408-411 | 4 | 9 |
| β-strand | 416-424 | 9 | 9 |
| β-strand | 430-437 | 8 | 9 |
| β-strand | 455-456 | 2 | 9 |
| β-strand | 459-460 | 2 | 9 |
| α-helix | 464 | 1 | |
| β-strand | 465-472 | 8 | 8 |
| β-strand | 476 | 1 | 13 |
| α-helix | 481-483 | 3 | |
| α-helix | 487-490 | 4 | |
| β-strand | 491 | 1 | 13 |
| β-strand | 496-503 | 8 | 8 |
| α-helix | 505-509 | 5 | |
| β-strand | 515-518 | 4 | 8 |
| β-strand | 522-525 | 4 | 8 |
| β-strand | 537-543 | 7 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamine tRNA | B | RNA | 75 | ||
| Glutaminyl-tRNA synthetase | A | protein | 556 | Escherichia coli | P00962 (AlphaFold model) |
>2RD2_1 Glutamine tRNA (chains B) GGGGGUAUCGCCAAGCGGUAAGGCACCGGAUUCUGAUUCCGGCAUUCCGAGGUUCGAAUC CUCGUACCCCAGCCA
>2RD2_2 Glutaminyl-tRNA synthetase (chains A) MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKG QCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLA YVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMA SPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLRTLEFQDNRRL YDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRR GYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYQGE GEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIKA ERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPVEIRLYDRLFSVP NPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFN RTVGLRDTLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| QSI | 5'-O-[N-(L-glutaminyl)-sulfamoyl]adenosine | C15 H22 N8 O8 S | 1 |
Water and common crystallization additives (SO4) are not listed.
A rationally engineered misacylating aminoacyl-tRNA synthetase. Bullock, T.L., Rodriguez-Hernandez, A., Corigliano, E.M. et al. Proc Natl Acad Sci U S A (2008) 105:7428-7433. DOI 10.1073/pnas.0711812105 · PubMed
Other PDB entries of the same protein (UniProt P00962 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RD2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.