2RGT: PDB entry 2RGT

Crystal Structure of Lhx3 LIM domains 1 and 2 with the binding domain of Isl1. Determined by X-ray diffraction at 2.05 Å resolution. Released 12 Aug 2008.

Method: X-ray diffraction
Resolution: 2.05 Å
Organisms: Mus musculus, synthetic construct
Chains: 2
Atoms: 2,425
Mol. weight: 37.73 kDa
Ligands: ZN
Released: 12 Aug 2008

Explore 2RGT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RGT contains 19 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	1
β-strand	34	1	2
β-strand	40	1	1
β-strand	47-48	2	2
β-strand	53-54	2	2
β-strand	60	1	3
α-helix	66	1
β-strand	67	1	3
α-helix	68	1
β-strand	73-74	2	4
β-strand	79-80	2	4
α-helix	82-89	8
α-helix	91	1
β-strand	92	1	5
α-helix	93	1
β-strand	99	1	5
β-strand	105-109	5	6
β-strand	112-115	4	6
α-helix	116-118	3
β-strand	120	1	7
α-helix	126	1
β-strand	127	1	7
α-helix	128	1
β-strand	133-136	4	8
β-strand	142-144	3	8
α-helix	145-153	9
β-strand	263-266	4	8
α-helix	267-270	4
β-strand	271-272	2	6

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	9
β-strand	34	1	10
β-strand	40	1	9
β-strand	45-49	5	10
β-strand	52-54	3	10
α-helix	56-58	3
β-strand	60	1	11
α-helix	66	1
β-strand	67	1	11
α-helix	68	1
β-strand	71-72	2	12
β-strand	73-75	3	13
β-strand	78-80	3	13
α-helix	82-89	8
β-strand	92	1	14
β-strand	99	1	14
β-strand	106	1	15
β-strand	107-109	3	16
β-strand	112-114	3	16
α-helix	116-118	3
β-strand	120	1	17
α-helix	126	1
β-strand	127	1	17
α-helix	128-129	2
β-strand	133-136	4	18
β-strand	142-144	3	18
α-helix	145-148	4
β-strand	263-266	4	18
α-helix	267-270	4
β-strand	271	1	15
β-strand	280-281	2	12
β-strand	282-286	5	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1	A, B	protein	169	Mus musculus, synthetic construct	P50481 (AlphaFold model), P61372 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2RGT_1 Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1 (chains A, B)
GSTPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDF
FKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCK
ADYETAKQGGSGGSGGSGGGTPMVAASPERHDGGLQANPVEVQSYQPPW

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Primary citation

Implementing the LIM code: the structural basis for cell type-specific assembly of LIM-homeodomain complexes. Bhati, M., Lee, C., Nancarrow, A.L. et al. EMBO J (2008) 27:2018-2029. DOI 10.1038/emboj.2008.123 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2RGT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.