2RIQ: Third Zinc-binding domain of human PARP-1

Crystal Structure of the Third Zinc-binding domain of human PARP-1. Determined by X-ray diffraction at 1.7 Å resolution. Released 8 Jan 2008.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,257
Mol. weight: 18.78 kDa
Ligands: EOH, ZN
Released: 8 Jan 2008

Explore 2RIQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RIQ contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	226-255	30
α-helix	258-267	10
α-helix	276-289	14
β-strand	291-292	2	1
α-helix	293-295	3
α-helix	300-301	2
β-strand	302-305	4	2
β-strand	308-311	4	2
β-strand	314-316	3	3
β-strand	319-320	2	3
β-strand	324-325	2	2
β-strand	330-331	2	1
α-helix	337-340	4
α-helix	342-347	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly [ADP-ribose] polymerase 1	A	protein	160	Homo sapiens	P09874 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RIQ_1 Poly [ADP-ribose] polymerase 1 (chains A)
MVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPS
GESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWV
TPKEFREISYLKKLKVKKQDRIFPPETSASVALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
EOH	Ethanol	C2 H6 O	1
ZN	Zinc ion	Zn	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

A Third Zinc-binding Domain of Human Poly(ADP-ribose) Polymerase-1 Coordinates DNA-dependent Enzyme Activation. Langelier, M.F., Servent, K.M., Rogers, E.E. et al. J Biol Chem (2008) 283:4105-4114. DOI 10.1074/jbc.M708558200 · PubMed

Other PDB entries of the same protein (UniProt P09874 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NRH 1.5 Å, Crystal Structure of human PARP-1 ART domain bound inhibitor UTT63
9ETQ 1.59 Å, Crystal structure of PARP1 catalytic domain bound to AZD5305 (SARUPARIB)
7AAC 1.59 Å, Crystal structure of the catalytic domain of human PARP1 in complex with veliparib
6NRJ 1.65 Å, Crystal Structure of human PARP-1 ART domain bound to inhibitor UTT93
7KK2 1.7 Å, Structure of the catalytic domain of PARP1
6NRG 1.7 Å, Crystal Structure of human PARP-1 ART domain bound to inhibitor UTT57
7KK5 1.7 Å, Structure of the catalytic domain of PARP1 in complex with niraparib
7AAA 1.74 Å, Crystal structure of the catalytic domain of human PARP1 (apo)
6NTU 1.8 Å, Crystal Structure of human PARP-1 ART domain bound to inhibitor UKTT-15
9ETR 1.82 Å, Crystal structure of PARP1 catalytic domain bound to AZD9574
7ONT 1.85 Å, PARP1 catalytic domain in complex with a selective pyridine carboxamide-based inhibitor…
4ZZZ 1.9 Å, Structure of human PARP1 catalytic domain bound to an isoindolinone inhibitor

Browse structure collections

About this viewer

MolViewer shows 2RIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.