2RJ2: F-box only protein 2

Name: PDB 2RJ2: Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
Published: 2008-10-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution. Determined by X-ray diffraction at 1.7 Å resolution. Released 14 Oct 2008.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,755
Mol. weight: 21.25 kDa
Ligands: NI
Released: 14 Oct 2008

Explore 2RJ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RJ2 contains 3 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	116-123	8
β-strand	141-145	5	1
β-strand	151-154	4	2
β-strand	171-174	4	2
β-strand	180-187	8	1
α-helix	195-196	2
α-helix	197-201	5
β-strand	204-212	9	2
β-strand	219-229	11	1
β-strand	234-239	6	1
β-strand	243-244	2	1
β-strand	252-258	7	2
β-strand	265-276	12	1
β-strand	287-296	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box only protein 2	A	protein	185	Mus musculus	Q80UW2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RJ2_1 F-box only protein 2 (chains A)
GSHMFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDGNVEFTQDDSVKKY
FASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENE
DVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSS
VWVEP

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution. Vaijayanthimala, S., Velmurugan, D., Mizushima, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q80UW2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UMH 2.0 Å, Structural basis of sugar-recognizing ubiquitin ligase
5B4N 2.3 Å, Structure analysis of function associated loop mutant of substrate recognition domain of…
1UMI 2.4 Å, Structural basis of sugar-recognizing ubiquitin ligase
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2E33 2.7 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2E32 3.52 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 2RJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.