The NMR structure of the submillisecond folding intermediate of the Thermus thermophilus ribonuclease H. Determined by solution NMR. Released 31 Mar 2009.
Explore 2RPI in 3D Show helices and sheets RCSB PDB PDBe
2RPI contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9 | 1 | 1 |
| β-strand | 12 | 1 | 2 |
| α-helix | 26-40 | 15 | |
| β-strand | 48 | 1 | 1 |
| β-strand | 49-51 | 3 | 2 |
| α-helix | 57-62 | 6 | |
| α-helix | 66-71 | 6 | |
| β-strand | 75 | 1 | 3 |
| β-strand | 81 | 1 | 3 |
| α-helix | 85-94 | 10 | |
| β-strand | 101-103 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribonuclease H | A | protein | 112 | Thermus thermophilus HB8 | P29253 (AlphaFold model) |
>2RPI_1 Ribonuclease H (chains A) MNPSPRKRVALFTDGAALGNPGPGTTNNRMELKAAIEGLKALKEPAEVDLYTDSHYLKKA FTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHRVRFHFVKHHHHHH
The high-resolution NMR structure of the early folding intermediate of the Thermus thermophilus ribonuclease H. Zhou, Z., Feng, H., Ghirlando, R. et al. J Mol Biol (2008) 384:531-539. DOI 10.1016/j.jmb.2008.09.044 · PubMed
Other PDB entries of the same protein (UniProt P29253 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RPI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.